Inscrever-se
Conecte-se
Vexels Logo

7775 Ícones de esporte em SVG, PNG, AI.

Baixar Ícones de esporte em SVG, PNG, AI para uso comercial.

Você quis dizer: esports ?

Resultados patrocinados daShutterstock Logo
Ganhe 15% de desconto com o código: VXL15
Seeker man illustration

Não encontramos nenhum esporte Ícones, mas aqui estão todos os nossos esporte designs ou solicitar design aqui

Design de boxe com silhuetas

Boxing design featuring colorful silhouettes of people throwing punches

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Design de camiseta de unicórnio musculoso

para Mercht-shirt icon
Pronto para imprimir
A funny t-shirt design featuring a muscular unicorn with pink back drop and a tiny colorful stars around him

Fabricante de logomarca de futebol

Editable design to create your own soccer logo label or badge

Design de camisetas de futebol americano

para Mercht-shirt icon
Nice sports t-shirt design featuring six american football balls with different designs in blue and yellow color grouped by three and "American football" caption between them Bonito diseno de camiseta deportiva con seis balones de futbol americano con diferentes disenos en color azul y amarillo agrupados por tres y la leyenda "Futbol americano" entre ellos Belo design de camiseta esportiva com seis bolas de futebol americano com designs diferentes em azul e amarelo agrupados por tres e a legenda "Futebol americano" entre elas Schones Sport-T-Shirt-Design mit sechs American-Football-Ballen mit verschiedenen Designs in blauer und gelber Farbe gruppiert nach drei und "American-Football" -Zeichen zwischen ihnen

Logotipo ilustrado do boxe

Boxing logo design featuring illustrated gloves

Criador da etiqueta do logotipo do time de futebol

Editable design where you can create your own soccer logo badge or label

Design de camisetas Bull Boxer

para Mercht-shirt icon
Pronto para imprimir
Cool imaginary t-shirt design features a boxer in guard pose with head of a bull

Design de camiseta masculina Running

para Mercht-shirt icon
Pronto para imprimir
Running Men T-Shirt Design featuring some men running a marathon with the phrase Just Keep Going

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Logo do time de futebol do Irã Desenho PNG

Logo do time de futebol do Irã

Conjunto de silhueta de moto

Collection of 12 motorcycle vehicle silhouettes featuring classic cruiser sport off-road scooter bikes

Design de camisetas para ioga

para Mercht-shirt icon
Pronto para imprimir
Yoga Quote T-Shirt Design featuring lettering that reads "Yoga" on top and "Mind + Body + Spirit"

Desenho de t-shirt de raposa skatista cartoon

para Mercht-shirt icon
Pronto para imprimir
Cute t-shirt design featuring a colorful cartoon illustration of a fox skateboarding

Ilustração Snowboard Heartbeat

Snowboarding design featuring a heartbeat illustration with a person doing snowboard in the middle

Banners de boxe hóquei e sinuca

Grungy set of 3 banners with paint splatters and distinctive elements of each sport or game

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Logotipo da seleção japonesa de futebol Desenho PNG

Logotipo da seleção japonesa de futebol

Conjunto de logotipo de academia de boxe

Set of boxing logos with editable text

Design de camiseta de futebol e cerveja

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design featuring an illustration of a beer glass and a soccer ball with the caption "Fussball & bier das lob ich mir" Can be used on t-shirts hoodies mugs posters and any other merchandise

Conjunto de silhuetas de paraquedas e pára-quedistas

Set of silhouettes featuring different extreme sports like sky diving powered paraglider and more

Design de camiseta com citações de tiro com arco

para Mercht-shirt icon
Archery Quote T-shirt Design featuring a quote related to the archery niche saying "SOME SAY LIVE LAUGH LOVE I SAY RAISE AIM SHOOT"

Anti conjunto de distintivos de desenho animado do dia dos namorados

Premiumcrown icon
Funny anti valentines day badge set that features quotes such as "Cause of death: drama" and "Ghosting is my favorite sport"

Design de camisetas para esportes radicais de motocross

para Mercht-shirt icon
T-shirt design featuring a motocross silhouette jumping across the sky

Design grunge esportivo

Grunge sport banner that contains a tennis player an american football player and a ice-hockey player over a grunge banner with paint splatters

Conjunto de silhueta de futebol americano

Collection of American Football player silhouettes in different positions running standing catching the ball and celebrating a goal

Design de camiseta de patinação artística

para Mercht-shirt icon
Beautiful ice skating t-shirt design featuring silhouette of woman performing Biellmann spin figure skating element with a spiral line around her and "Born to Ice Skate" caption Hermoso diseno de camiseta de patinaje sobre hielo con la silueta de una mujer que realiza el elemento de patinaje artistico de giro Biellmann con una linea en espiral a su alrededor y la leyenda "Born to Ice Skate" Lindo design de camiseta de patinacao no gelo com a silhueta de uma mulher realizando um elemento de patinacao artistica em rotacao de Biellmann com uma linha espiral ao redor dela e a legenda "Born to Ice Skate" Wunderschones Eislauf-T-Shirt-Design mit der Silhouette einer Frau die ein Biellmann-Spin-Eiskunstlaufelement mit einer Spirallinie um sie herum und der Beschriftung "Born to Ice Skate" ausfuhrt

Design de camisetas de skate

para Mercht-shirt icon
Pronto para imprimir
Skateboarding t-shirt design featuring a skater silhouette jumping across the sky

Botas para design de camisetas de caminhada

para Mercht-shirt icon
Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Design de camiseta Turbocharger illustraiton

para Mercht-shirt icon
Pronto para imprimir
Amazing t-shirt design that features a tribal sport illustration

Design de t-shirt do emblema do surf

para Mercht-shirt icon
T-shirt design featuring a surfer silhouette among the waves

Caminhada Forest T-Shirt Design

para Mercht-shirt icon
Pronto para imprimir
Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Design de camiseta de escalada de Utah

para Mercht-shirt icon
Pronto para imprimir
T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Desenho de t-shirt com ilustração de bicicleta

para Mercht-shirt icon
T-shirt design featuring a mountain bike rider silhouette against a distressed background

Design de camiseta T-Rex de tênis

para Mercht-shirt icon
Pronto para imprimir
Tennis T-Rex T-Shirt Design featuring a Dinosaur playing a Tennis match having some trouble with his short arms! Can be used on t-shirts hoodies mugs posters and any other merchandise

Fundo de futebol da Rússia 2018

Original football background for the 2018 World Cup championship in Russia featuring two transparent players chasing a football ball over Saint Basil's Cathedral silhouette Fondo de futbol original para el campeonato de la Copa del Mundo 2018 en Rusia con dos jugadores transparentes persiguiendo una pelota de futbol sobre la silueta de la Catedral de San Basilio Plano de fundo original do futebol para o campeonato da Copa do Mundo de 2018 na Russia com dois jogadores transparentes perseguindo uma bola de futebol sobre a silhueta da Catedral de Sao Basilio Ursprunglicher Fuballhintergrund fur die Weltmeisterschaft 2018 in Russland mit zwei transparenten Spielern die einen Fuball uber Silhouette der Kathedrale des Heiligen Basilius jagen

Design de camiseta para caminhadas e aventura na vida

para Mercht-shirt icon
Pronto para imprimir
Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Banners de estádios da Copa do Mundo 2018

Set of three Russia 2018 World Cup football championship host stadium banners with the championship logo below - Luzhniki St

Ilustração do estádio de futebol da copa do mundo

Beautiful football world cup background for the Russia 2018 World Cup championship with a football stadium in front of buildings skyline in red blue and white colors Hermoso fondo de la copa mundial de futbol para el campeonato de la Copa del mundo Rusia 2018 con un estadio de futbol frente al horizonte de edificios en colores rojo azul y blanco Lindo plano de fundo da copa do mundo de futebol para o campeonato da Russia da Copa do Mundo de 2018 com um estadio de futebol em frente ao horizonte dos edificios nas cores vermelho azul e branco Schoner Fuball-Weltcup-Hintergrund fur die Russland-Weltmeisterschaft 2018 mit einem Fuballstadion vor der Skyline des Gebaudes in den Farben Rot Blau und Wei

Banners de estádios de futebol da Rússia

Set of three Russia 2018 World Cup football championship host stadium banners with the championship logo above - Kazan arena Kaliningrad and Fisht Conjunto de tres banderas del estadio anfitrion del campeonato de futbol de la Copa Mundial Rusia 2018 con el logotipo del campeonato arriba: Kazan arena Kaliningrado y Fisht Conjunto de tres banners do estadio anfitriao do campeonato do mundo de futebol da Copa do Mundo da Russia 2018 com o logotipo do campeonato acima - Arena Kazan Kaliningrado e Fisht Satz von drei Bannern der Fuball-Weltmeisterschaft Russland 2018 mit Stadionlogo mit dem Meisterschaftslogo oben - Kasaner Arena Kaliningrad und Fisht

Silhueta do pacote de windsurf

Collection of windsurfing sport silhouettes

Modelo de capa do facebook de mulher com fotografia retrô

Premiumcrown icon
Amazing retro-style social media post a photograph of a woman next to a sports car

Rússia 2018 recebe faixas do estádio

Set of three Russia 2018 World Cup football championship host stadium banners with the championship logo below - Rostov arena Samara and Volgograd Conjunto de tres carteles del estadio anfitrion del campeonato de futbol de la Copa Mundial Rusia 2018 con el logotipo del campeonato a continuacion: Rostov Arena Samara y Volgogrado Conjunto de tres banners de estadio anfitriao do campeonato do mundo de futebol da Copa do Mundo da Russia 2018 com o logotipo do campeonato abaixo - arena Rostov Samara e Volgogrado Satz von drei Bannern der Fuball-Weltmeisterschaft Russland 2018 mit Stadionlogo mit dem Meisterschaftslogo unten - Arena Rostow Samara und Wolgograd

Pacote de ícones de 37 esportes simples

Set with a lot of sport icons in black and white: uniforms objects balls equipment trophies etc

Ilustração 3D da bola de vôlei

Volleyball design featuring a volley ball in white and yellow over a brown background

Carro Juke Nissan Preto e Branco

Juke mini sport car manufactured by Nissan Japan in outline mostly with a bit shade touch to the glasses wheels in black and white style artwork

Mascote do Rio 2016 Tom

Rio 2016 Olympics design featuring the illustrated mascot Tom

Sequência de silhuetas de rebatidas de jogadores de beisebol

Sequence of baseball player batting silhouettes

Equipamentos de ginástica e esportes

Different fitness and sport instruments in detail glossy style illustration

Logotipo da bola de tênis amarela Desenho PNG

Premiumcrown icon
A vibrant yellow logo featuring a tennis ball, capturing the spirit of the sport with its bright color and iconic imagery
Impulsione seu negóciocom a plataforma gráfica líder para merch
VER PLANOS