Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

527 Gráficos e Designs de caminhada para Camisetas e Merch print on demand

Baixar designs de camisetas e para merch, como capas de livro, capas de celular, tote bags e mais de caminhada

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Lanterna colorida com desenho de paisagem cênica Desenho PNG

Charming illustration of a camping lantern featuring a serene mountain landscape and river inside

Conjunto de ilustrações isoladas de montanhas

Set of mountain illustrations in different tones and shapes

Design de camisetas Hate People

Pronto para imprimir

Camping retro themed t-shirt design featuring an illustration of a camping site on a circular frame with "I hate people" caption

Design de candeeiro a óleo com ilustração de paisagem montanhosa. Desenho PNG

Charming illustration in a lantern showing mountains and a sun motif

Design de camiseta com citação do parque nacional olímpico

Pronto para imprimir

Awesome t-shirt design featuring pine trees over a mountain and the quote "Winter hiking warms my soul"

Paisagem plana de floresta montanhosa

Flat landscape illustration featuring lots of mountains and woods

Com as palavras caminhe e procure Desenho PNG

A white with black text that reads "Hike and Seek" written across the front

Design de camisetas Mountain Love

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Camiseta psd de animais e flores de gatinho fofo

texto editável

Pronto para imprimir

Cute t-shirt design featuring a cat surrounded by flowers and the quote "Looks like a walk in the meadows"

Conjunto de ícones de silhueta de montanha

Mountain icon set featuring 16 mountain designs in silhouette style

Design de camiseta de desenho retrô empanada de torta de carne

texto editável

Pronto para imprimir

Amazing t-shirt design that features a retro cartoon empanada walking

Design de camisetas para Boy on Rock Landscape

Pronto para imprimir

T-shirt design featuring a boy on top of a rock holding a balloon

Ilustração de montanhas de aventura de caminhadas

Adventure illustration featuring a human silhouette doing hiking

Vamos obter um design de camisetas realmente alto

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Crachás de acampamento

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Logotipo da montanha vintage Desenho PNG

Logotipo da montanha vintage

Ícones e elementos de acampamento

Camping is one big way of enjoy life outdoors

Projeto de paisagem de montanha plana

Flat winter landscape illustration featuring lots of mountains snow and woods

Design de camisetas para caminhadas ao ar livre

Pronto para imprimir

Hiking Outdoors T-Shirt Design featuring three hikers going up a mountain with a nice forest scene behind them

Mountain Calling T-shirt Design

Cool t-shirt design showing a badge with mountains illustration and "Mountains Are Calling" caption

Ilustração de paisagem montanhosa de inverno

Flat illustration featuring a field with some trees and mountains on the horizon

O cabelo do acampamento não se importa com as citações engraçadas Design de camisetas de acampamento

Camp Hair Don't Care Funny Quote Camping T-shirt Design depicting a bonfire and a quote that says Camp Hair Don't Care perfect for camping hiking and outdoor activities

Montanhas aguardam design de camisetas

Cool Black and white T-shirt design with a mountain over the clouds illustration

6 modelos de logotipo de distintivo de montanha

Set of mountain labels or badges

Paisagem florestal com árvores altas

Illustration featuring a pine tree forest viewed from the ground

Projeto de paisagem de natureza plana

Flat landscape illustration featuring lots of hills fields and woods

Conjunto de ilustração de montanha isolada

Set of mountain illustrations in different shapes and tones

Ilustração de paisagem de floresta plana

Flat landscape illustration featuring a forest mountain and river

Identificação do vetor comum prático

Identification of practical common vector image in

Paisagem de floresta verde com veados

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Conjunto de elementos de acampamento plano

Set of elements featuring camping related illustrations like bonfire trailer tent and other camping equipments and necessities

Ilustração de paisagem de campo calmo

Flat illustration featuring a field with some hills on the horizon

Design de camiseta de desenho animado de família de dinossauros

texto editável

Pronto para imprimir

Cool t-shirt design featuring a dinosaur family with a mother and two children and the quote "Motherhood is a walk in the park"

Ilustração de acampamento plana

Flat illustration featuring a camping on a forest with a tent campfire and other details

Paisagem de inverno com neve e árvores

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Ilustração de paisagem de acampamento com fogueira

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Modelo de logotipo moderno da montanha

Conjunto de silhuetas de pessoas para caminhadas e escaladas

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Paisagem de floresta e montanhas com veados

Flat landscape illustration featuring lots of trees mountains and a deer

Ilustração de montanha com neve

Flat winter landscape illustration featuring lots of mountains snow and some woods

Kit de sobrevivência para acampamento

This amazing set of camping survival kit has a collection of the most important elements for camping and hiking world

A aventura espera o design de camisetas para experiências ao ar livre

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Ilustração do nascer do sol nas montanhas

Low poly illustration featuring moutains and the sun rays coming through them

Paisagem da ilustração do pôr do sol da floresta

Flat landscape illustration featuring a forest with light coming through the tree branches

Design do modelo do logotipo do emblema da montanha

Projeto de ilustração de paisagem de montanha

Flat illustration featuring moutains and their reflection

Um com o design da camiseta das montanhas

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Modelo de logotipo abstrato de montanha

Design de t-shirt zumbi monstro ambulante

Pronto para imprimir

Spooky t-shirt design featuring a zombie walking forward with the quote "Do the zombie walk" written in blood

de 11

Impulsione seu negóciocom a plataforma gráfica líder para merch