Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

3149 Gráficos e Designs de e esporte para Camisetas e Merch print on demand

Baixar designs de camisetas e para merch, como capas de livro, capas de celular, tote bags e mais de e esporte

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VEXELS15

Conjunto de skates pretos

Cool illustration set featuring various skateboards in black

Caminhada design de camiseta com citação alemã

ConteÃºdo em alemÃ£o

Pronto para imprimir

Cool t-shirt design featuring the quote in German "Mehr wandern weniger sorgen" (More hiking less worries)

Conjunto de silhueta feminina de handebol

Nice silhouette set featuring six female handball players in different postures

Design de t-shirt Kick Boxing

Pronto para imprimir

Kick Boxing T-Shirt design featuring an illustration of a fist punching to the front and two letterings

Logotipo da tipografia Palms Sun Beach

Conjunto de 6 bolas de rugby

These are just 6 rugby balls in different colors and styles

Design de camiseta esportiva para casal

texto editÃ¡vel

Pronto para imprimir

Cool t-shirt design featuring a mimic of a sports jersey with the number 01 and the title "His queen"

Design de camiseta de esqueleto de academia

texto editÃ¡vel

Pronto para imprimir

Cool t-shirt design featuring a retro cartoon skeleton lifting gym weights, with the quote "PR or ER"

Animal tigre jogando basquete design de camiseta

Pronto para imprimir

Cool t-shirt design featuring a tiger playing basketball

Design de camiseta rainha do halterofilismo

Pronto para imprimir

Cool t-shirt design featuring a woman weightlifting with the caption "Queen"

Design de camiseta de unicórnio musculoso

Pronto para imprimir

A funny t-shirt design featuring a muscular unicorn with pink back drop and a tiny colorful stars around him

Design de camiseta com citação motivacional de academia de agachamento

texto editÃ¡vel

Pronto para imprimir

Awesome t-shirt design that features a quote that reads "Squat 'til you can't walk"

Design de camiseta de unicórnio de karatê bonito

Pronto para imprimir

Cool t-shirt design that features a unicorn doing karate and the quote "Sweet but dangerous"

Design de camiseta com cinto de luta livre

Pronto para imprimir

T-shirt design featuring a golden wrestling belt

Cole??o de silhuetas femininas

Huge set of silhouettes featuring women in different scenarios such as shopping doing sports business and more

Silhueta de menina Pilates com bola

Pilates has became a popular way of becoming fit and healthly

Design de camiseta com citação de fitness calistenia

texto editÃ¡vel

Pronto para imprimir

Cool t-shirt design featuring the quote "My warm up is your workout"

Design de camiseta monocromática de jogador de basquete

texto editÃ¡vel

Pronto para imprimir

Fun t-shirt design featuring a person playing basketball and the quote "Alley hoop, jump shot, hoopster"

Fabricante de logotipo de artes marciais

Animal gato jogando design de camiseta de beisebol

Pronto para imprimir

Awesome t-shirt design featuring a cat playing baseball and the quote "Pawfessional furball batter"

Design de camiseta de futebol de bandeira argentina

texto editÃ¡vel

Pronto para imprimir

Awesome t-shirt design that features the Argentinian flag with a soccer ball

Menino de anime jogando design de camiseta de futebol

Pronto para imprimir

Amazing t-shirt design featuring an anime boy playing soccer

Pacote de silhueta de estilo livre de motocross

Silhouette pack featuring various motocross freestyle riders performing different stunts

Bowling recortam conjunto

Awesome set of bowling people

Dinossauro T-rex jogando golfe design de camiseta

Pronto para imprimir

Cool t-shirt design featuring a dinosaur playing golf

A menina adora o design de camisetas de basquete

Pronto para imprimir

Cool t-shirt design featuring a basketball and the quote "Just a girl who loves basketball"

Design de camisetas Kitesurfer

Pronto para imprimir

T-shirt design featuring a kitesurfer riding on a wave

Design de camiseta de mãe de basquete

texto editÃ¡vel

Pronto para imprimir

Cool t-shirt design featuring the title "Basketball mom" with a basketball net and ball, and an animal print background

Levante como um design de camiseta de menina

Pronto para imprimir

Cool t-shirt design that features a strong girl and the quote "Lift like a girl"

Dinossauro T-rex jogando design de camiseta de futebol

Pronto para imprimir

Amazing t-shirt design that features a t-rex dinosaur with a football ball against a rainbow

Design de camiseta com emblema de futebol americano

Pronto para imprimir

Cool t-shirt design featuring a sport badge with a football and the quote "Fantasy football legend"

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Conjunto de silhueta de raquetes de padel

Amazing sport-themed set that features a series of silhouettes of paddle tennis racquets, all in different shape and sizes

Design de camiseta de gnomos de minigolfe

texto editÃ¡vel

Pronto para imprimir

Amazing t-shirt design that features gnomes playing mini-golf and the quote "Mini golf squad"

Silhuetas de jogadores de futebol americano

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Skeleton skatista fazendo t-shirt de acrobacias psd

Pronto para imprimir

Cool t-shirt psd featuring a person with a skull for a head skateboarding and the quote "Skate your dreams"

Este está trabalhando no design da camiseta

Pronto para imprimir

Check out this awesome training t-shirt design featuring two hands and the quote 'This one is working out today'

Design de camiseta de bola esportiva de beisebol punk

Pronto para imprimir

Cool t-shirt design featuring a baseball with a punk look and the quote "Baseball college league"

Design fixe de t-shirt de basebol americano

Pronto para imprimir

Great American t-shirt design with the quote "As American as baseball" and a baseball ball with two bats

Caminhada Forest T-Shirt Design

Pronto para imprimir

Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Design de camiseta masculina Running

Pronto para imprimir

Running Men T-Shirt Design featuring some men running a marathon with the phrase Just Keep Going

Cenografia de jogador de futebol americano

Amazing character set, one player is sending the pass and the other running for a catch

Design de camiseta de evolução Pickleball

Pronto para imprimir

An Evolution t-shirt design featuring a sequence of iconic images capturing the progress of evolution, from single-celled organism to a pickleball player

Design de camiseta de motocicleta de sujeira grunge

Pronto para imprimir

Cool t-shirt design that features a biker riding a motorcycle in front of a US flag

Conjunto de adesivos retrô de boliche

Awesome set of retro bowling stickers

6 emblemas de esportes radicais

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Design de camiseta com citação engraçada do vovô Pickleball

texto editÃ¡vel

Pronto para imprimir

Fun t-shirt design that features the quote "Some grandpas play bingo but badass grandpas play pickleball"

Mulheres fazendo design de camiseta de artes marciais de jiu jitsu

Pronto para imprimir

Awesome t-shirt design featuring two women doing jiu jitsu

Design de camiseta esportiva de curling

Pronto para imprimir

Cool t-shirt design that features a curling player and the quote "Curling"

Design de t-shirt de paddleboard heartbeat

Pronto para imprimir

Amazing t-shirt design depicting a man doing paddleboarding between the lines of a heartbeat

de 63

Impulsione seu negóciocom a plataforma gráfica líder para merch