Inscrever-se
Conecte-se
Vexels Logo
All
Pesquisa Aleatória

7767 Gráficos e Designs de esporte para Camisetas e Merch print on demand

Baixar designs de camisetas e para merch, como capas de livro, capas de celular, tote bags e mais de esporte

Resultados patrocinados daShutterstock Logo
Ganhe 15% de desconto com o código: VEXELS15

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Conjunto de 16 silhuetas de jogador de voleibol

This set contains 16 silhouettes of volleyball players hitting the ball in many positions jumping throwing themselves etc

Conjunto de silhueta de raquetes de padel

Premiumcrown icon
Amazing sport-themed set that features a series of silhouettes of paddle tennis racquets, all in different shape and sizes

Pessoa caminhando montanhas Desenho PNG

Pessoa caminhando montanhas

Design de camiseta de gnomos de minigolfe

para Mercht-shirt icon
texto editável
Pronto para imprimir
Amazing t-shirt design that features gnomes playing mini-golf and the quote "Mini golf squad"

Conjunto de silhueta de jogador de hóquei

Premiumcrown icon
Cool set design that features multiple hockey player silhouettes in different positions

Letras múltiplas de futebol americano Desenho PNG

Letras múltiplas de futebol americano

Conjunto de silhueta de boxe

Cool sports themed vector set featuring five silhouettes of boxing player fighting in different poses

Silhuetas de jogadores de futebol americano

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Skeleton skatista fazendo t-shirt de acrobacias psd

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt psd featuring a person with a skull for a head skateboarding and the quote "Skate your dreams"

Este está trabalhando no design da camiseta

para Mercht-shirt icon
Pronto para imprimir
Check out this awesome training t-shirt design featuring two hands and the quote 'This one is working out today'

Vista lateral do skate cortada Desenho PNG

Vista lateral do skate cortada

Design de camiseta de bola esportiva de beisebol punk

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design featuring a baseball with a punk look and the quote "Baseball college league"

Design fixe de t-shirt de basebol americano

para Mercht-shirt icon
Pronto para imprimir
Great American t-shirt design with the quote "As American as baseball" and a baseball ball with two bats

descida - 0 Desenho PNG

descida - 0

snowboard - 3 Desenho PNG

snowboard - 3

Silhueta de mulher escalando Desenho PNG

Silhueta de mulher escalando

Caminhada Forest T-Shirt Design

para Mercht-shirt icon
Pronto para imprimir
Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Design de camiseta masculina Running

para Mercht-shirt icon
Pronto para imprimir
Running Men T-Shirt Design featuring some men running a marathon with the phrase Just Keep Going

Cenografia de jogador de futebol americano

Amazing character set, one player is sending the pass and the other running for a catch

Design de camiseta de evolução Pickleball

para Mercht-shirt icon
Pronto para imprimir
An Evolution t-shirt design featuring a sequence of iconic images capturing the progress of evolution, from single-celled organism to a pickleball player

Conjunto de adesivos retrô de boliche

Premiumcrown icon
Awesome set of retro bowling stickers

Silhueta de lado do reformador de Pilates Desenho PNG

Silhueta de lado do reformador de Pilates

Ilustração de skate preto Desenho PNG

Ilustração de skate preto

Jogador mantendo a silhueta do gol Desenho PNG

Premiumcrown icon
Jogador mantendo a silhueta do gol

6 emblemas de esportes radicais

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Bola de futebol de vetor realista

Vector soccer ball

Design de camiseta de motocicleta de sujeira grunge

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design that features a biker riding a motorcycle in front of a US flag

Design de camiseta com citação engraçada do vovô Pickleball

para Mercht-shirt icon
texto editável
Pronto para imprimir
Fun t-shirt design that features the quote "Some grandpas play bingo but badass grandpas play pickleball"

Mulheres fazendo design de camiseta de artes marciais de jiu jitsu

para Mercht-shirt icon
Pronto para imprimir
Awesome t-shirt design featuring two women doing jiu jitsu

Design de camiseta esportiva de curling

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design that features a curling player and the quote "Curling"

Design de t-shirt de paddleboard heartbeat

para Mercht-shirt icon
Pronto para imprimir
Amazing t-shirt design depicting a man doing paddleboarding between the lines of a heartbeat

Conjunto de design de distintivo de basquete

Premiumcrown icon
Awesome badge set design that features eight different basketball badges in the colors orange white and blue

Conjunto de elementos de rugby

Awesome rugby set that features different rugby elements such as a rugby ball a field a goal post and more" all in black and white

Design de camiseta do jogo Petanca

para Mercht-shirt icon
Pronto para imprimir
Awesome t-shirt design that includes an illustration of a man playing petanque in silhouette style with the word Boule on top of it

Coleção de ilustrações da linha Pilates

Premiumcrown icon
Beautiful pilates themed collection featurin multiple line style illustrations of women in different poses

Vôlei de praia Desenho PNG

Premiumcrown icon
Vôlei de praia

Futebol americano Desenho PNG

Futebol americano

Conjunto de ícones de veículos

Here a second bunch of transport icons in side view

Conjunto de ícones de escolas acadêmicas

Set of icons related to academy university school etc

Conjunto de recortes de elementos de canoagem

Premiumcrown icon
Amazing set design that features different canoes and kayaks in cut-out style

Conjunto de silhuetas de jogadores de raquetebol

Premiumcrown icon
Cool silhouette set that features racquetball players in different poses

Sinal de citação de luta livre Desenho PNG

Premiumcrown icon
Sinal de citação de luta livre

Design de camiseta T-Rex de tênis

para Mercht-shirt icon
Pronto para imprimir
Tennis T-Rex T-Shirt Design featuring a Dinosaur playing a Tennis match having some trouble with his short arms! Can be used on t-shirts hoodies mugs posters and any other merchandise

Homem correndo com silhueta de chapéu Desenho PNG

Premiumcrown icon
Homem correndo com silhueta de chapéu

Futebol grã-bretanha Desenho PNG

Futebol grã-bretanha

Conjunto de ícones de troféus e prêmios

Are you a winner? Check out this set of several award badges trophy stars and ribbons

Conjunto de 20 silhuetas de rugby

Set with 20 silhouettes of rugby players doing different moves kicking the ball fighting for it running jumping etc

Monograma personalizável de lacrosse Desenho PNG

Monograma personalizável de lacrosse

Design de camiseta psd para jogador de futebol

para Mercht-shirt icon
Pronto para imprimir
Amazing psd t-shirt design featuring a running football player with quote "Hold the pigskin" in photographic style
de 156
Impulsione seu negóciocom a plataforma gráfica líder para merch
VER PLANOS