Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

7752 Gráficos e Designs de esporte para Camisetas e Merch print on demand

Baixar designs de camisetas e para merch, como capas de livro, capas de celular, tote bags e mais de esporte

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VEXELS15

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Conjunto de 16 silhuetas de jogador de voleibol

This set contains 16 silhouettes of volleyball players hitting the ball in many positions jumping throwing themselves etc

Conjunto de silhueta de raquetes de padel

Amazing sport-themed set that features a series of silhouettes of paddle tennis racquets, all in different shape and sizes

Pessoa caminhando montanhas Desenho PNG

Pessoa caminhando montanhas

Design de camiseta de gnomos de minigolfe

texto editÃ¡vel

Pronto para imprimir

Amazing t-shirt design that features gnomes playing mini-golf and the quote "Mini golf squad"

Conjunto de silhueta de jogador de hóquei

Cool set design that features multiple hockey player silhouettes in different positions

Design fixe de t-shirt de basebol americano

Pronto para imprimir

Great American t-shirt design with the quote "As American as baseball" and a baseball ball with two bats

snowboard - 3 Desenho PNG

snowboard - 3

Conjunto de silhueta de boxe

Cool sports themed vector set featuring five silhouettes of boxing player fighting in different poses

Silhuetas de jogadores de futebol americano

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Design de camiseta de evolução Pickleball

Pronto para imprimir

An Evolution t-shirt design featuring a sequence of iconic images capturing the progress of evolution, from single-celled organism to a pickleball player

Skeleton skatista fazendo t-shirt de acrobacias psd

Pronto para imprimir

Cool t-shirt psd featuring a person with a skull for a head skateboarding and the quote "Skate your dreams"

Este está trabalhando no design da camiseta

Pronto para imprimir

Check out this awesome training t-shirt design featuring two hands and the quote 'This one is working out today'

Vista lateral do skate cortada Desenho PNG

Vista lateral do skate cortada

Design de camiseta de bola esportiva de beisebol punk

Pronto para imprimir

Cool t-shirt design featuring a baseball with a punk look and the quote "Baseball college league"

descida - 0 Desenho PNG

descida - 0

Silhueta de mulher escalando Desenho PNG

Silhueta de mulher escalando

Caminhada Forest T-Shirt Design

Pronto para imprimir

Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Design de camiseta masculina Running

Pronto para imprimir

Running Men T-Shirt Design featuring some men running a marathon with the phrase Just Keep Going

Cenografia de jogador de futebol americano

Amazing character set, one player is sending the pass and the other running for a catch

Design de camiseta de motocicleta de sujeira grunge

Pronto para imprimir

Cool t-shirt design that features a biker riding a motorcycle in front of a US flag

Conjunto de adesivos retrô de boliche

Awesome set of retro bowling stickers

Silhueta de lado do reformador de Pilates Desenho PNG

Silhueta de lado do reformador de Pilates

Ilustração de skate preto Desenho PNG

Ilustração de skate preto

Jogador mantendo a silhueta do gol Desenho PNG

Jogador mantendo a silhueta do gol

6 emblemas de esportes radicais

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Bola de futebol de vetor realista

Vector soccer ball

Design de camiseta com citação engraçada do vovô Pickleball

texto editÃ¡vel

Pronto para imprimir

Fun t-shirt design that features the quote "Some grandpas play bingo but badass grandpas play pickleball"

Mulheres fazendo design de camiseta de artes marciais de jiu jitsu

Pronto para imprimir

Awesome t-shirt design featuring two women doing jiu jitsu

Design de camiseta esportiva de curling

Pronto para imprimir

Cool t-shirt design that features a curling player and the quote "Curling"

Design de t-shirt de paddleboard heartbeat

Pronto para imprimir

Amazing t-shirt design depicting a man doing paddleboarding between the lines of a heartbeat

Conjunto de design de distintivo de basquete

Awesome badge set design that features eight different basketball badges in the colors orange white and blue

Conjunto de elementos de rugby

Awesome rugby set that features different rugby elements such as a rugby ball a field a goal post and more" all in black and white

Design de camiseta do jogo Petanca

Pronto para imprimir

Awesome t-shirt design that includes an illustration of a man playing petanque in silhouette style with the word Boule on top of it

Coleção de ilustrações da linha Pilates

Beautiful pilates themed collection featurin multiple line style illustrations of women in different poses

Vôlei de praia Desenho PNG

Vôlei de praia

Futebol americano Desenho PNG

Futebol americano

Conjunto de ícones de veículos

Here a second bunch of transport icons in side view

Conjunto de ícones de escolas acadêmicas

Set of icons related to academy university school etc

Conjunto de recortes de elementos de canoagem

Amazing set design that features different canoes and kayaks in cut-out style

Conjunto de silhuetas de jogadores de raquetebol

Cool silhouette set that features racquetball players in different poses

Hóquei-T-Shirts-Vinil - 7 Desenho PNG

Hóquei-T-Shirts-Vinil - 7

Sinal de citação de luta livre Desenho PNG

Sinal de citação de luta livre

Design de camiseta T-Rex de tênis

Pronto para imprimir

Tennis T-Rex T-Shirt Design featuring a Dinosaur playing a Tennis match having some trouble with his short arms! Can be used on t-shirts hoodies mugs posters and any other merchandise

Homem correndo com silhueta de chapéu Desenho PNG

Homem correndo com silhueta de chapéu

Homem esquiando silueta Desenho PNG

Homem esquiando silueta

Futebol grã-bretanha Desenho PNG

Futebol grã-bretanha

Conjunto de ícones de troféus e prêmios

Are you a winner? Check out this set of several award badges trophy stars and ribbons

Conjunto de 20 silhuetas de rugby

Set with 20 silhouettes of rugby players doing different moves kicking the ball fighting for it running jumping etc

Krav maga artes marciais esportes silhuetas

Awesome sport-themed set that features a series of silhouettes of people practicing krav maga martial arts moves

de 156

Impulsione seu negóciocom a plataforma gráfica líder para merch