Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

2140 Gráficos e Designs de silhuetas para Camisetas e Merch print on demand

Baixar designs de camisetas e para merch, como capas de livro, capas de celular, tote bags e mais de silhuetas

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Coleção de silhuetas de fotógrafo

Collection of isolated photographers shooting photos silhouettes in different poses

Conjunto de silhuetas de sereia

Big set of mermaid silhouettes in tones of blue

Mantenha o design de camiseta de meditação focado

Pronto para imprimir

Check this great meditation t-shirt design including a meditating woman's silhouette in a retro sunset background and the quote 'Negativity spreads between minds like locusts

Silhueta fazendo design de camiseta de calistenia

texto editável

Pronto para imprimir

Fun t-shirt design featuring a person exercising and the quote "Never give up only pull up"

Coleção de silhuetas de esquilo

Big set of squirrel silhouettes in tones of orange and brown

Conjunto de silhueta de pessoas dançando linha

Check this cool figures set including different people performing line dance! The elements of this set can be isolated for individual use! Mira este genial conjunto de figuras que incluye a diferentes personas bailando en linea! Los elementos de este conjunto se pueden aislar para uso individual! Confira este conjunto de figuras legais, incluindo diferentes pessoas realizando danca de linha! Os elementos deste conjunto podem ser isolados para uso individual! Schauen Sie sich dieses coole Figurenset mit verschiedenen Personen an, die Line Dance auffuhren! Die Elemente dieses Sets konnen zur individuellen Verwendung isoliert werden!

Silhueta de futebol infantil Desenho PNG

Silhueta de futebol infantil

Cavalo correndo silhuetas de quadros de sequência

Horse running sequence frames silhouettes

Fundo das silhuetas da nuvem dos desenhos animados

Backdrop design made from cloud silhouettes in black over white

Silhuetas de ajuda do Dia Global dos Beatles

Great poster for Global Beatles Day featuring the Help silhouettes in multiple colors over black background

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Design de modelo de caneca de treino de calistenia

texto editável

Pronto para imprimir

Cool mug template featuring a person doing calisthenics and the quote "Just one more rep"

Conjunto de corte de pessoas soprando vidro

Check out this cool cut-out set of people making blown glass objects! Each character of this set can be separated for individual use

Silhueta de bola de futebol de homem Desenho PNG

Silhueta de bola de futebol de homem

Coleção de silhuetas em ferradura

Collection of eight isolated horseshoes silhouettes with different design

Sequência de silhuetas de rebatidas de jogadores de beisebol

Sequence of baseball player batting silhouettes

Silhuetas de poses de ioga

Collection of men and women doing yoga poses silhouettes

Design de camiseta de silhueta de esporte de calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring a person doing a pull up and the quote "Push up, pull up, muscle up"

Coleção de silhuetas de músicos

Big set of musicians silhouettes featuring musicians playing guitar drums singing and more

Conjunto de 20 silhuetas de rugby

Set with 20 silhouettes of rugby players doing different moves kicking the ball fighting for it running jumping etc

Design de t-shirt de evolução do tênis de padel

Pronto para imprimir

Cool t-shirt design that features the paddle tennis evolution in silhouette style

Conjunto de silhuetas de carros e caminhonetes

Collection of silhouettes featuring different cars pickup trucks station wagons and more

Design de camiseta de força esportiva de calistenia

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a person doing calisthenics and the quote "My body my gym"

160 silhuetas de animais

Here is a big set with 160 silhouettes of domestic farm and wild animal species

Design de camisetas de animais da floresta

Pronto para imprimir

Cool t-shirt adorned with a colorful design featuring a deer, bear, eagle, and fox, showcasing his love for nature and wildlife

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Homem fazendo pull ups calistenia design de t-shirt

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a man doing pulls ups and the quote "Pull up and shut up"

Silhuetas de pássaros voando

Flying bird motion silhouettes

Conjunto de silhuetas de símbolos africanos de Adinkra

Silhouette set featuring numerous African Adrinka symbols

Design de camiseta de silhueta T-rex

texto editável

Pronto para imprimir

Cool t-shirt design featuring the word "T-Rex", surrounded with sikhouettes of t-rex dinosaurs

Pessoa exercitando design de camiseta de calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring a person exercising and the quote "Just one more rep"

Ilustração de silhuetas de amizade

Colorful silhouettes of kids running around under the word friendship in capital letters

Design de camiseta de evolução do grill

Pronto para imprimir

Cool t-shirt design that features the grill man evolution

Conjunto de silhueta de evolução do artista

Cool silhouette set design that features the evolution of a paint artist

Design de camiseta com citação de esporte de calistenia

texto editável

Pronto para imprimir

Amazing t-shirt design featuring the quote "Strong without weights"

46 silhuetas de meninas dançando

Set of 46 girl dancers silhouettes in different positions and dancing styles

Conjunto de silhueta de pessoas dançando pop

Awesome hobby-themed set that features a series of people dancing in different ways in silhouette style

Design de camiseta com citação de fitness calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring the quote "My warm up is your workout"

Homem de boliche e silhueta de bola Desenho PNG

Homem de boliche e silhueta de bola

Silhuetas de meninas dançando em vetor grátis

Unique collection 32 silhouettes of dancing girls

Homem fazendo design de sacola de calistenia

texto editável

Pronto para imprimir

Amazing tote bag design featuring a person doing calisthenics and the quote "Turn off gravity"

Irmãs jogando design de camiseta

Pronto para imprimir

Look at this cool t-shirt design of two sisters playing on a swing by a tree

Design de camiseta de força de núcleo esportivo de calistenia

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a person doing calisthenics and the quote "No gravity club"

Violino formado por design de t-shirt de notas musicais

Pronto para imprimir

Cool t-shirt design that features a violin silhouette formed by musical notes

Conjunto de silhuetas de cavalos

Huge collection of horse silhouettes in different postures and activities

Design legal de camiseta com amuleto

Pronto para imprimir

Great t-shirt design with a chimney sweep silhouette and the german quote "Everyone needs their lucky charm"

Silhueta de futebol infantil Desenho PNG

Silhueta de futebol infantil

Coleção de silhuetas de bebês

Big set of silhouettes featuring babies in different poses and postures

Mulher silhueta de esporte de badminton Desenho PNG

Mulher silhueta de esporte de badminton

de 43

Impulsione seu negóciocom a plataforma gráfica líder para merch