Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

2140 Gráficos de designs PNG e SVG de silhuetas

Baixar Gráficos PNG e SVG de Design com Fundo Transparente Para T-Shirts, Capas do Celular, Capas do Livros e outros Produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Seeker man illustration

Não encontramos nenhum silhuetas PNGs, mas aqui estão todos os nossos silhuetas designs ou solicitar design aqui

Cervos correndo silhuetas de quadros de movimento

Deer running sequence frames silhouettes

Silhuetas de fantasias infantis de Halloween

Halloween silhouettes of children with several costumes: witches wizards pirates monsters devils and more

?Silhueta de bola de futebol de criança Desenho PNG

?Silhueta de bola de futebol de criança

Coleção de silhuetas de gráficos heráldicos

Silhouette collection featuring numerous heraldic graphics incluing badges lions eagles wings and wreaths

Conjunto de silhuetas de estrela e brilho

Beautiful sky themed vector set featuring six different style of stars and sparkle silhouettes in white

Coleção de silhuetas de casas

This vector contains 9 house silhouettes of different sizes and architectures

Conjunto de silhuetas de carros e caminhonetes

Collection of silhouettes featuring different cars pickup trucks station wagons and more

Sequências de silhuetas de pássaros voando

Flying bird sequence silhouettes

Silhueta de futebol de criança Desenho PNG

Silhueta de futebol de criança

Dove voando silhuetas de sequência

Dove flying sequence silhouettes

Ilustração de silhuetas de corrida brilhante

Running design featuring colorful silhouettes of people running and doing sports

Coleção de silhuetas de esquilo

Big set of squirrel silhouettes in tones of orange and brown

15 silhuetas de troféu

This set has 15 silhouettes of trophies with different shapes; some of these have the classical cup design others have a ball a star or a more elegant style

Conjunto de silhuetas de símbolos africanos de Adinkra

Silhouette set featuring numerous African Adrinka symbols

Silhuetas de homens de trabalho com picaretas

Hardworking day labor men silhouettes holding pickaxes with 4 different positions wearing comfortable uniform helmet and shoes

Homem silhueta de badminton Desenho PNG

Homem silhueta de badminton

Conjunto de silhuetas de kick-boxing

Set of kick boxing silhouettes featuring multiple positions and poses

Conjunto de silhuetas de pessoas para caminhadas e escaladas

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Silhuetas da cidade de Los Angeles em 4 de julho

Background of Los Angeles city silhouettes for July 4th celebration with buildings and landmarks in colors of USA flag

Mulher silhueta de pessoas de badminton Desenho PNG

Mulher silhueta de pessoas de badminton

Silhuetas de jogadores de futebol americano

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Silhuetas de colagem de pontos de referência mundiais

This is a nice vector to use in material of travel agencies touristic companies and similar stuff; it has a message of Travel around the world in the center of some circles from which emerge several silhouettes of famous landmarks of continents around the world

Mulher silhueta de badminton Desenho PNG

Mulher silhueta de badminton

Silhuetas de salto de bola de jogadores de futebol

Silhouettes of soccer playersa jumping to hit the ball in various positions; perfect vector for using in sport promos

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Conjunto de silhuetas de dançarinos de salsa

Big set of silhouettes featuring salsa dancers in different poses and postures

Silhueta de esporte de futebol de homem Desenho PNG

Silhueta de esporte de futebol de homem

Conjunto de silhuetas de animais marinhos

Set with 20 silhouettes of sea animals: fishes mammals reptiles mollusks crustaceans etc

Coleção de silhuetas de fotógrafo

Collection of isolated photographers shooting photos silhouettes in different poses

Coleção de silhuetas de dançarinos de hip hop

Big set of silhouettes featuring hip hop dancers in different poses and postures

Silhueta de futebol de futebol de homem Desenho PNG

Silhueta de futebol de futebol de homem

Conjunto de silhuetas de esportes de neve

Snow sports silhouettes set

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Pacote de silhuetas de artes marciais

Big set of martial arts silhouettes with lots of positions from different types of martial arts

Silhuetas de poses de ioga

Collection of men and women doing yoga poses silhouettes

Conjunto de silhuetas de pessoas pulando

Silhouette set featuring five people in different jumping positions and pauses and can be use separately

Conjunto de silhuetas de folhas tropicais

Set of silhouettes featuring illustrated palm tree leaves

Design de t-shirt de evolução do tênis de padel

Pronto para imprimir

Cool t-shirt design that features the paddle tennis evolution in silhouette style

Animal gato em silhuetas de movimento

Cat in motion silhouettes it is running and jumping in a sequence of 20 figures

Coleção de silhuetas de tango

Big set of silhouettes featuring tango dancers doing different poses and dances

Desenho de silhuetas de tênis brilhantes

Tennis design featuring colorful silhouettes of people playing tennis

Design de boxe com silhuetas

Boxing design featuring colorful silhouettes of people throwing punches

Silhuetas femininas de compras da Black Friday

Black Friday ad with 3 shopping women silhouettes with bags

Conjunto de silhuetas de vacas

Big set of silhouettes featuring different cows in different postures

Conjunto de silhuetas de sereia

Big set of mermaid silhouettes in tones of blue

Coleção de silhuetas em ferradura

Collection of eight isolated horseshoes silhouettes with different design

Silhueta de pessoas de badminton de homem Desenho PNG

Silhueta de pessoas de badminton de homem

Coleção de silhuetas de músicos

Big set of musicians silhouettes featuring musicians playing guitar drums singing and more

silhueta de futebol de homem Desenho PNG

silhueta de futebol de homem

Impulsione seu negóciocom a plataforma gráfica líder para merch