Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

18242 Designs de Camisetas e Mockups PSD de silhueta

Baixar designs de camisetas ou mockups PSD editáveis de silhueta

Seeker man illustration

Não encontramos nenhum silhueta PSDs, mas aqui estão todos os nossos silhueta designs ou solicitar design aqui

Coleção Family Silhouette

Family silhouette collection featuring four sets of family silhouettes with mother father and children

Ilustração básica de impressão digital

Basic fingerprint illustration design in black and white

Ilustração colorida de dinossauro

Nice colorful prehistoric background featuring dinosaur extinction scenery with dinosaur silhouettes and volcano and meteors in the background Bonito fondo prehistorico colorido con paisajes de extincion de dinosaurios con siluetas de dinosaurios y volcanes y meteoritos en el fondo Belo fundo pre-historico colorido com um cenario de extincao de dinossauros com silhuetas de dinossauros e vulcao e meteoros ao fundo Schoner bunter prahistorischer Hintergrund der Dinosaurier-Ausloschungslandschaft mit Dinosaurier-Silhouetten und Vulkan und Meteoren im Hintergrund kennzeichnet

Paisagem industrial com fábricas

This design features a city skyline over a sunset with lots of buildings and tower cranes

Design de camiseta com ilustração de Tóquio

Pronto para imprimir

T-shirt design featuring an illustrated Tokyo skyline with its famous buildings

Conjunto de silhuetas de carros e caminhonetes

Collection of silhouettes featuring different cars pickup trucks station wagons and more

Conjunto de ilustração retrô do sol

Nice vector set featuring three illustrations of retro syle sunsets with different elements

Design de camiseta neon em Las Vegas

T-shirt design featuring a Las Vegas skyline in a bright and colorful style with the traditional landmarks (Eiffel Tower Statue of Liberty London Eye and more)

Design de camiseta gradiente com batimento cardíaco de gato

Modern t-shirt design featuring a heart shape with a cat silhouette formed by an EKG line, set against a pink and blue gradient background with retro sunburst rays

Design de sacola ninja esportiva Pickleball

texto editável

Pronto para imprimir

A cool tote bag design featuring a fierce, silhouette of a pickleball player in ninja attire, radiating an aura of fear and intensity

Caminhadas design de capa de livro alemão KDP

texto editável

Pronto para imprimir

Beautiful book cover design featuring a silhouette of a mountain landscape and a hiker walking, with the German title "Wandern Notizbuch"

Fundo assustador da noite de Halloween

Halloween night party background contains a ghost tree a hunted house by a creepy tree with cemetery in the middle

Design de camiseta de unicórnio de bolinhas rosa

Pronto para imprimir

Awesome t-shirt design featuring the silhouette of a unicorn made of pink polka dots

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Design de ilustração plana de impressão digital

Flat illustration featuring a gradient fingerprint over a black background

Design de camiseta feminina da cidade

Pronto para imprimir

Cool t-shirt design of a woman and a city's silhouette

Ilustração do horizonte de Los Angeles

United States' Los Angeles skyline design in black

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Conjunto de silhuetas de símbolos africanos de Adinkra

Silhouette set featuring numerous African Adrinka symbols

Design de camiseta de surfe de cowgirl retrô

Vintage style t-shirt design showing a cowgirl silhouette surfing with text: "Cowgirl summer vibe"

Design de capa de livro de planejador de fitness KDP

texto editável

Pronto para imprimir

Cool book cover design for a fitness planner, with the silhouette of a woman lifting weights

Manhattan Grung Skyline

Cool grunge New York Manhattan background featuring all major landmarks of the metropolis

Design de caneca de casal de mãos dadas

texto editável

Pronto para imprimir

Beautiful mug design featuring a silhouette of a couple holding hands at with a mountain in the background

Coleção de silhuetas de fotógrafo

Collection of isolated photographers shooting photos silhouettes in different poses

Pacote de 12 cupcakes

Set of 12 cupcakes silhouettes illustrated in the same style but featuring different flavors and garnishes

Design de camiseta de bastão de lacrosse de bandeira americana

Pronto para imprimir

A patriotic t-shirt design featuring a lacrosse stick silhouette fused with the American flag motif, creating a bold and unique statement

Projeto do horizonte do Rio de Janeiro Brasil

Rio de Janeiro skyline design in dark tones

Criador de pôsteres do horizonte mundial

Editable design featuring lots of skylines from cities all over the world to choose from

Coleção de silhuetas de instrumentos musicais

Silhouette collection featuring different musical instruments like drums piano violin guitar and more! Can be used separately

Design de camiseta para evento da semana da bicicleta

Retro t-shirt design showing a motorcycle silhouette against a sunset beach scene with palm trees and text: "Crabby's oceanside bike week"

Design de camiseta de corda apertada ao vivo em fita

texto editável

Pronto para imprimir

Look at this cool t-shirt design for tight rope fans including a person's silhouette in a retro sunset background and the quote 'Live on tape'

Padrão de pinheiros e flocos de neve

Nice seasonal seamless winter pattern featuring Christmas trees and snoflakes silhouettes

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Quadro de fundo de palmeiras

Illustrated palm tree leaves in tones of green

Ilustração do pôster de Viagem a Paris

Illustrated Paris skyline featuring it's most important buildings

Design de camiseta de motivação de corrida

Pronto para imprimir

Amazing t-shirt design that features the silhouette of a person running and the quote "Every mile is worth it"

Silhuetas de poses de ioga

Collection of men and women doing yoga poses silhouettes

Conjunto de ícones de lobo

Set of wolf icons in different styles

Horizonte de Natal do México

Christmas illustration featuring Mexico skyline with silhouettes of its cultural landmarks buildings and even a Santa with his reindeer across the sky

Design de bolsa de elefante republicano

texto editável

Pronto para imprimir

Check out this cool tote bag design of the Republican party including an elephant silhouette over the USA's map and the quote 'USA 1776 United States of America'

Conjunto de símbolos egípcios

Silhouette set featuring a number of Ancient Egypt symbols

Coleção de silhuetas de músicos

Big set of musicians silhouettes featuring musicians playing guitar drums singing and more

Design de camiseta motivacional para corrida alemã

Modern t-shirt design featuring a runner silhouette with motivational German text that means: "I've had enough, I'm going for a run", in colorful typography layout

Vetor de lançamento de nave espacial Desenho PNG

Vetor de lançamento de nave espacial

Design de camiseta com citação de escalada engraçada

Pronto para imprimir

Check this great climibing t-shirt design including a climber's silhouette and the French quote 'I can't I have climbing'

Design de camiseta alemã de vitória em corrida

Modern t-shirt design featuring a triumphant runner silhouette against a green backdrop with the text "He does nothing, just wants to run" in German

Design de camiseta de liberdade indomável

texto editável

Pronto para imprimir

Cool t-shirt design featuring the silhouette of a wolf howling, and the quote "Untamed freedom"

Vetor de árvore frondosa Desenho PNG

Vetor de árvore frondosa

Garota que ama design de camiseta de búfalos

texto editável

Pronto para imprimir

Great t-shirt design that features a buffalo silhouette and the quote "Just a girl who loves buffaloes"

Design de camiseta de kitesurf

texto editável

Pronto para imprimir

Cool t-shirt design that features a kitesurf silhouette and water splash with the quote "Spray and pray"

Impulsione seu negóciocom a plataforma gráfica líder para merch