Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

1600 Designs Vetoriais de abenteuer para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de abenteuer para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VEXELS15

Seeker man illustration

Não encontramos nenhum abenteuer Vetores, mas aqui estão todos os nossos abenteuer designs ou solicitar design aqui

Modelo de design para camiseta Design de carro de rali com tipografia ousada

Edit Online Badge

Dynamic rally car design featuring a classic racing vehicle in motion

Modelo de design para camiseta Projeto de astronauta para viagem espacial

Edit Online Badge

Bold graphic design featuring an astronaut in a space suit, surrounded by a globe motif

Modelo de design para camiseta Explore o design do globo infinito

Edit Online Badge

Modern and dynamic poster design featuring a prominent globe illustration with continents

Modelo de design para camiseta Design gráfico de surf de astronauta

Edit Online Badge

Playful and adventurous, this poster design features an astronaut skillfully surfing a vibrant wave

Modelo de design para camiseta Design de citação de fogueira encantadora

Edit Online Badge

Playful t-shirt design featuring the quote 'Life is better by a bonfire'

Guerreiro poderoso com design de guitarra elétrica Desenho PNG

Dynamic and bold, this illustration features a muscular warrior raising an electric guitar that resembles a weapon

Design divertido de snowboarder em desenho animado Desenho PNG

Charming and whimsical, this illustration features a cartoon character expertly snowboarding down a slope

Ilustração artística de figuras submersas em água Desenho PNG

Contemporary and evocative, this poster design features a unique depiction of two legs sticking out of the water, surrounded by submerged heads

Design de balão de coração caprichoso Desenho PNG

Playful hot air balloon design featuring vibrant pink colors and detailed heart motifs

Design lúdico de scooter com rodas em chamas Desenho PNG

Vibrant and playful, this digital illustration features a scooter in bold pink, complete with fiery flames shooting from its wheels

Design icônico da silhueta do Pé Grande Desenho PNG

Bold graphic design featuring a walking bigfoot silhouette, perfect for T-shirts or wall art

HyggeRelaxElements - 4 Desenho PNG

HyggeRelaxElements - 4

Caminhadas silhueta de homem Desenho PNG

Caminhadas silhueta de homem

Design gráfico de dirigível vintage Desenho PNG

Sleek and minimalist, this design features a vintage airship rendered in a bold dark blue against a light gray background

Paisagem de floresta verde com veados

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Caminhada silhueta de aventura Desenho PNG

Caminhada silhueta de aventura

Paisagem de inverno com neve e árvores

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

CustomizableBlanks_GeometricSanSerif_vinyl - 1 Desenho PNG

CustomizableBlanks_GeometricSanSerif_vinyl - 1

Emblemas de etiqueta retrô para caminhadas e camping

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

Crachás de acampamento

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Design de padrão de silhuetas de acampamento

padrÃ£o tileable

Check this great camping tileable pattern design including different camping elements like tents, lamps, wild animals and more! Edit and use this tileable pattern design for your design projects, wallpapers, backgrounds and more

Paisagem plana de floresta montanhosa

Flat landscape illustration featuring lots of mountains and woods

Cruzeiro dos desenhos animados viajando pelo mar

Cartoon Cruise traveling on the sea

Design colorido de esqui

This beautiful and colorful design show a man skiing making a jump

9 emblemas de viagem

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Ilustração do pôr do sol no deserto plano

Flat sunset illustration featuring a desert with cactus

Ilustração do pôr do sol na praia

Flat sunset illustration featuring a beach with palm trees

Ilustração de Sunset Beach

Flat sunset illustration featuring a beach with palm trees

Emblemas de logotipos de acampamento retrô e emblemas de caminhada

Paisagem de montanha

Illustrated nature landscape featuring mountains trees and clouds

Ilustração de aventura de inverno em carro roadtrip

Amazing illustration that features a car travelling across mountains and trees and the quote "Winter travel"

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Projeto de paisagem de montanha plana

Flat winter landscape illustration featuring lots of mountains snow and woods

Silhueta de caminhadas Desenho PNG

Silhueta de caminhadas

HatDecals-Icons - 34 Desenho PNG

HatDecals-Icons - 34

Projeto de ilustração de paisagem de montanha

Flat illustration featuring moutains and their reflection

6 emblemas de esportes radicais

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Ilustração do pôr do sol sobre as montanhas

Flat illustration featuring the sun going down behind some mountains and forests

Projeto de paisagem de natureza plana

Flat landscape illustration featuring lots of hills fields and woods

Homem hiking silueta Desenho PNG

Homem hiking silueta

Ilustração de paisagem de floresta com neve

Flat illustration featuring a forest with falling snow and bokeh

Ilustração de uma paisagem de floresta

Flat landscape illustration featuring lots of trees field and river

Conjunto de curso de elemento de acampamento

Amazing set featuring different camping elements in stroke style

Ilustração de paisagem de acampamento com fogueira

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Paisagem de floresta e montanhas com veados

Flat landscape illustration featuring lots of trees mountains and a deer

Ilustração de paisagem de montanha

Flat illustration featuring moutains over a blue sky

HatDecals-DobleImage - 8 Desenho PNG

HatDecals-DobleImage - 8

Crachá de caminhada de aventura Desenho PNG

Crachá de caminhada de aventura

Paisagem da ilustração do pôr do sol da floresta

Flat landscape illustration featuring a forest with light coming through the tree branches

Mapa do tesouro para colorir Desenho PNG

Mapa do tesouro para colorir

de 32

Impulsione seu negóciocom a plataforma gráfica líder para merch