Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

1863 Designs Vetoriais de aventura para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de aventura para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VEXELS15

Seeker man illustration

Não encontramos nenhum aventura Vetores, mas aqui estão todos os nossos aventura designs ou solicitar design aqui

Design de citação encantadora de campistas felizes Desenho PNG

Playful t-shirt design featuring the phrase 'Happy Campers' in whimsical script

Edit Online Badge

Modelo de design para camiseta Design futurista de astronauta com tema de passeio pelo universo

Vibrant and captivating poster design featuring a detailed illustration of a female astronaut in a space helmet

Design lúdico estilo praia flamingo Desenho PNG

Vibrant and playful, this graphic design features a whimsical pink flamingo soaring through a starry sky

Edit Online Badge

Modelo de design para camiseta Design futurista de tropa canina com um cão espacial

Bold digital illustration showcasing a stylized dog character wearing advanced headphones and a sleek helmet

Edit Online Badge

Modelo de design para camiseta Arte de videogame retrô com monstros espaciais

Playful t-shirt design showcasing vibrant illustrations of space monsters and a heroic character

Edit Online Badge

Modelo de design para camiseta Design elegante de citação de pássaros grátis

Striking and whimsical, this poster design features two birds in flight, symbolizing freedom

Edit Online Badge

Modelo de design para camiseta Design intrincado de crânio de alce com tema de natureza

Striking and detailed, this t-shirt design features an intricate illustration of a moose skull adorned with foliage and antlers

Edit Online Badge

Modelo de design para camiseta Design lúdico de ciclismo com cavalos e citações motivacionais

Dynamic and playful, this t-shirt design features a cartoon horse character energetically riding a bicycle

Desenho de princesa e unicórnio para colorir Desenho PNG

Playful coloring page featuring a whimsical princess riding a unicorn

Edit Online Badge

Modelo de design para camiseta Cartaz de viagem para a praia paradisíaca de Tulum

Vibrant travel poster design showcasing Tulum's enchanting seaside landscape

Edit Online Badge

Modelo de design para camiseta Design de carro de rali com tipografia ousada

Dynamic rally car design featuring a classic racing vehicle in motion

Edit Online Badge

Modelo de design para camiseta Projeto de astronauta para viagem espacial

Bold graphic design featuring an astronaut in a space suit, surrounded by a globe motif

Edit Online Badge

Modelo de design para camiseta Design gráfico de surf de astronauta

Playful and adventurous, this poster design features an astronaut skillfully surfing a vibrant wave

Edit Online Badge

Modelo de design para camiseta Design de citação de fogueira encantadora

Playful t-shirt design featuring the quote 'Life is better by a bonfire'

Guerreiro poderoso com design de guitarra elétrica Desenho PNG

Dynamic and bold, this illustration features a muscular warrior raising an electric guitar that resembles a weapon

Design divertido de snowboarder em desenho animado Desenho PNG

Charming and whimsical, this illustration features a cartoon character expertly snowboarding down a slope

Ilustração artística de figuras submersas em água Desenho PNG

Contemporary and evocative, this poster design features a unique depiction of two legs sticking out of the water, surrounded by submerged heads

HyggeRelaxElements - 4 Desenho PNG

HyggeRelaxElements - 4

Caminhadas silhueta de homem Desenho PNG

Caminhadas silhueta de homem

Design gráfico de dirigível vintage Desenho PNG

Sleek and minimalist, this design features a vintage airship rendered in a bold dark blue against a light gray background

Paisagem de floresta verde com veados

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Paisagem de inverno com neve e árvores

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

CustomizableBlanks_GeometricSanSerif_vinyl - 1 Desenho PNG

CustomizableBlanks_GeometricSanSerif_vinyl - 1

Crachás de acampamento

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Design de padrão de silhuetas de acampamento

padrÃ£o tileable

Check this great camping tileable pattern design including different camping elements like tents, lamps, wild animals and more! Edit and use this tileable pattern design for your design projects, wallpapers, backgrounds and more

Paisagem plana de floresta montanhosa

Flat landscape illustration featuring lots of mountains and woods

Cruzeiro dos desenhos animados viajando pelo mar

Cartoon Cruise traveling on the sea

Design colorido de esqui

This beautiful and colorful design show a man skiing making a jump

9 emblemas de viagem

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Ilustração do pôr do sol no deserto plano

Flat sunset illustration featuring a desert with cactus

Ilustração do pôr do sol na praia

Flat sunset illustration featuring a beach with palm trees

Ilustração de Sunset Beach

Flat sunset illustration featuring a beach with palm trees

Paisagem de montanha

Illustrated nature landscape featuring mountains trees and clouds

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Projeto de paisagem de montanha plana

Flat winter landscape illustration featuring lots of mountains snow and woods

Silhueta de caminhadas Desenho PNG

Silhueta de caminhadas

HatDecals-Icons - 34 Desenho PNG

HatDecals-Icons - 34

Projeto de ilustração de paisagem de montanha

Flat illustration featuring moutains and their reflection

6 emblemas de esportes radicais

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Ilustração do pôr do sol sobre as montanhas

Flat illustration featuring the sun going down behind some mountains and forests

Projeto de paisagem de natureza plana

Flat landscape illustration featuring lots of hills fields and woods

Homem hiking silueta Desenho PNG

Homem hiking silueta

Ilustração de paisagem de floresta com neve

Flat illustration featuring a forest with falling snow and bokeh

Ilustração de uma paisagem de floresta

Flat landscape illustration featuring lots of trees field and river

Ilustração de paisagem de acampamento com fogueira

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Paisagem de floresta e montanhas com veados

Flat landscape illustration featuring lots of trees mountains and a deer

Conjunto de curso de elemento de acampamento

Amazing set featuring different camping elements in stroke style

Ilustração de paisagem de montanha

Flat illustration featuring moutains over a blue sky

HatDecals-DobleImage - 8 Desenho PNG

HatDecals-DobleImage - 8

Paisagem da ilustração do pôr do sol da floresta

Flat landscape illustration featuring a forest with light coming through the tree branches

de 38

Impulsione seu negóciocom a plataforma gráfica líder para merch