Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

7693 Designs Vetoriais de esporte para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de esporte para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Você quis dizer: esports ?

Seeker man illustration

Não encontramos nenhum esporte Vetores, mas aqui estão todos os nossos esporte designs ou solicitar design aqui

Design de camiseta de futebol e cerveja

Pronto para imprimir

Cool t-shirt design featuring an illustration of a beer glass and a soccer ball with the caption "Fussball & bier das lob ich mir" Can be used on t-shirts hoodies mugs posters and any other merchandise

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Logotipo ilustrado do boxe

Design de camiseta de escalada de Utah

Pronto para imprimir

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Anti conjunto de distintivos de desenho animado do dia dos namorados

Funny anti valentines day badge set that features quotes such as "Cause of death: drama" and "Ghosting is my favorite sport"

Design de camiseta Turbocharger illustraiton

Pronto para imprimir

Amazing t-shirt design that features a tribal sport illustration

Design de camiseta com citações de tiro com arco

Archery Quote T-shirt Design featuring a quote related to the archery niche saying "SOME SAY LIVE LAUGH LOVE I SAY RAISE AIM SHOOT"

Banners de boxe hóquei e sinuca

Grungy set of 3 banners with paint splatters and distinctive elements of each sport or game

Design de camiseta de skatista alienígena

Pronto para imprimir

T-shirt design featuring an alien skater

Logotipo da bola de tênis amarelo e verde Desenho PNG

Design de camisetas Hunter Quote

Pronto para imprimir

Hunter Quote T-Shirt Design featuring text that reads: "If you want to be happy for a day get drunk for a year get married for a lifetime become a hunter" and illustration of a hunter with its dog

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Design de camiseta para caminhadas

Pronto para imprimir

Hiking Sloth T-Shirt Design featuring an illustration of a sloth with a hiking bag with text that says: Sloth Hiking Team weAll get there when we get there

Conjunto de silhueta de moto

Collection of 12 motorcycle vehicle silhouettes featuring classic cruiser sport off-road scooter bikes

Design de camiseta em quadrinhos de cerveja de futebol

Pronto para imprimir

Cool comic t-shirt design featuring a hand drawn comic about soccer and beer in black yellow and red

Design de camiseta de beisebol de astronauta

Pronto para imprimir

Cool t-shirt design showing an illustration of an astronaut playing baseball holding a bat and about to hit a meteorite that is painted as a baseball ball

Ilustração Snowboard Heartbeat

Snowboarding design featuring a heartbeat illustration with a person doing snowboard in the middle

Vista lateral de silhueta de ciclista Desenho PNG

Vista lateral de silhueta de ciclista

Fundo de futebol da Rússia 2018

Original football background for the 2018 World Cup championship in Russia featuring two transparent players chasing a football ball over Saint Basil's Cathedral silhouette Fondo de futbol original para el campeonato de la Copa del Mundo 2018 en Rusia con dos jugadores transparentes persiguiendo una pelota de futbol sobre la silueta de la Catedral de San Basilio Plano de fundo original do futebol para o campeonato da Copa do Mundo de 2018 na Russia com dois jogadores transparentes perseguindo uma bola de futebol sobre a silhueta da Catedral de Sao Basilio Ursprunglicher Fuballhintergrund fur die Weltmeisterschaft 2018 in Russland mit zwei transparenten Spielern die einen Fuball uber Silhouette der Kathedrale des Heiligen Basilius jagen

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Desenho de t-shirt de raposa skatista cartoon

Pronto para imprimir

Cute t-shirt design featuring a colorful cartoon illustration of a fox skateboarding

Conjunto de silhuetas de paraquedas e pára-quedistas

Set of silhouettes featuring different extreme sports like sky diving powered paraglider and more

Design de camisetas Kitesurfer

Pronto para imprimir

T-shirt design featuring a kitesurfer riding on a wave

Design grunge esportivo

Grunge sport banner that contains a tennis player an american football player and a ice-hockey player over a grunge banner with paint splatters

Conjunto de silhueta de futebol americano

Collection of American Football player silhouettes in different positions running standing catching the ball and celebrating a goal

Design de camiseta com halteres Minotauro

Pronto para imprimir

Minotaur Dumbbell T-Shirt Design featuring an illustration of a hard core minotaur raising a dumbbell with one hand

Rússia 2018 recebe faixas do estádio

Logotipo do time de futebol da Croácia Desenho PNG

Logotipo do time de futebol da Croácia

Design de camiseta para hóquei no gelo

Pronto para imprimir

Ice Hockey Dabbing T-Shirt Design featuring an ice hockey player celebrating a win with the viral dab dance! Can be used on t-shirts hoodies mugs posters and any other merchandise

Logo do time de futebol do Irã Desenho PNG

Design de t-shirt de mergulho do penhasco

Pronto para imprimir

Cool cliff diving t-shirt design featuring a cliff diver silhouette over a geometric landscape

Banners de estádios de futebol da Rússia

Ilustração do estádio de futebol da copa do mundo

Beautiful football world cup background for the Russia 2018 World Cup championship with a football stadium in front of buildings skyline in red blue and white colors Hermoso fondo de la copa mundial de futbol para el campeonato de la Copa del mundo Rusia 2018 con un estadio de futbol frente al horizonte de edificios en colores rojo azul y blanco Lindo plano de fundo da copa do mundo de futebol para o campeonato da Russia da Copa do Mundo de 2018 com um estadio de futebol em frente ao horizonte dos edificios nas cores vermelho azul e branco Schoner Fuball-Weltcup-Hintergrund fur die Russland-Weltmeisterschaft 2018 mit einem Fuballstadion vor der Skyline des Gebaudes in den Farben Rot Blau und Wei

Design de camiseta de futebol de abacate

Pronto para imprimir

Funny t-shirt design featuring an illustration of three cartoon avocados playing football

Design de camiseta alvo de tiro com arco

Archery Target T-shirt Design with two arrows and a target and the words CALM FOCUSED STEADY NOBLE for the archery niche

Banners de estádios da Copa do Mundo 2018

Silhueta do pacote de windsurf

Collection of windsurfing sport silhouettes

Carro Juke Nissan Preto e Branco

Juke mini sport car manufactured by Nissan Japan in outline mostly with a bit shade touch to the glasses wheels in black and white style artwork

Conjunto de emblemas de futebol americano

Collection of american football sports badges in colorful vintage style featuring american football helmet or ball with label and other elements Coleccion de insignias deportivas de futbol americano en estilo vintage colorido con casco o pelota de futbol americano con etiqueta y otros elementos Colecao de emblemas esportivos de futebol americano em estilo vintage colorido com capacete ou bola de futebol americano com etiqueta e outros elementos Sammlung von American-Football-Sportabzeichen im farbenfrohen Vintage-Stil mit American-Football-Helm oder -Ball mit Etikett und anderen Elementen

Pacote de ícones de 37 esportes simples

Set with a lot of sport icons in black and white: uniforms objects balls equipment trophies etc

Equipamentos de ginástica e esportes

Different fitness and sport instruments in detail glossy style illustration

Design de camiseta para mamãe softball

Pronto para imprimir

Softball Mom T-Shirt Design featuring an illustration of a baseball bat with a bow and a softball ball on the center with lettering around that reads: "Softball Mom"

Logotipo da bola de tênis amarela Desenho PNG

Ilustração 3D da bola de vôlei

Volleyball design featuring a volley ball in white and yellow over a brown background

Design alemão de camiseta de handebol

Conteúdo em alemão

Pronto para imprimir

German Handball T-Shirt Design featuring the text Team Germany 2019 with the german flag in the background and sporty player

Águia de desenho animado segurando uma bola de futebol Desenho PNG

A playful cartoon eagle holds a football in its talons, showing its love for the sport with a mischievous smile on its face

Mascote do Rio 2016 Tom

Rio 2016 Olympics design featuring the illustrated mascot Tom

Sequência de silhuetas de rebatidas de jogadores de beisebol

Sequence of baseball player batting silhouettes

É dia de jogo SVG Desenho PNG

An SVG image depicting the excitement of game day, with vibrant colors, cheering fans, and sports-related elements

Design personalizável de esportes de inverno

Editable design featuring tons of different winter sports silhouettes and backgrounds to choose from

Impulsione seu negóciocom a plataforma gráfica líder para merch