Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

2847 Designs Vetoriais de esporte para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de esporte para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Você quis dizer: esports ?

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Desenho de t-shirt de raposa skatista cartoon

Pronto para imprimir

Cute t-shirt design featuring a colorful cartoon illustration of a fox skateboarding

Design de camiseta de patinação artística

Beautiful ice skating t-shirt design featuring silhouette of woman performing Biellmann spin figure skating element with a spiral line around her and "Born to Ice Skate" caption Hermoso diseno de camiseta de patinaje sobre hielo con la silueta de una mujer que realiza el elemento de patinaje artistico de giro Biellmann con una linea en espiral a su alrededor y la leyenda "Born to Ice Skate" Lindo design de camiseta de patinacao no gelo com a silhueta de uma mulher realizando um elemento de patinacao artistica em rotacao de Biellmann com uma linha espiral ao redor dela e a legenda "Born to Ice Skate" Wunderschones Eislauf-T-Shirt-Design mit der Silhouette einer Frau die ein Biellmann-Spin-Eiskunstlaufelement mit einer Spirallinie um sie herum und der Beschriftung "Born to Ice Skate" ausfuhrt

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Logotipo ilustrado do boxe

Design de camisetas para ioga

Pronto para imprimir

Yoga Quote T-Shirt Design featuring lettering that reads "Yoga" on top and "Mind + Body + Spirit"

Design de camiseta Turbocharger illustraiton

Pronto para imprimir

Amazing t-shirt design that features a tribal sport illustration

Banners de boxe hóquei e sinuca

Grungy set of 3 banners with paint splatters and distinctive elements of each sport or game

Design de camiseta para caminhadas

Pronto para imprimir

Hiking Sloth T-Shirt Design featuring an illustration of a sloth with a hiking bag with text that says: Sloth Hiking Team weAll get there when we get there

Criador da etiqueta do logotipo do time de futebol

Design de camiseta de beisebol de astronauta

Pronto para imprimir

Cool t-shirt design showing an illustration of an astronaut playing baseball holding a bat and about to hit a meteorite that is painted as a baseball ball

Design de camiseta com halteres Minotauro

Pronto para imprimir

Minotaur Dumbbell T-Shirt Design featuring an illustration of a hard core minotaur raising a dumbbell with one hand

Design de camiseta de escalada de Utah

Pronto para imprimir

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Design de camiseta com citações para beber cerveja

Pronto para imprimir

Drink Beer Quote T-Shirt Design featuring text that reads: "Just let me shoot hoops drink beer & hang out with my bulldog" and illustrations of a beer bottle a bulldog and a basketball player

Anti conjunto de distintivos de desenho animado do dia dos namorados

Funny anti valentines day badge set that features quotes such as "Cause of death: drama" and "Ghosting is my favorite sport"

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Design de camiseta com citações de tiro com arco

Archery Quote T-shirt Design featuring a quote related to the archery niche saying "SOME SAY LIVE LAUGH LOVE I SAY RAISE AIM SHOOT"

Conjunto de logotipo de academia de boxe

Set of boxing logos with editable text

Design de t-shirt de mergulho do penhasco

Pronto para imprimir

Cool cliff diving t-shirt design featuring a cliff diver silhouette over a geometric landscape

Design grunge esportivo

Grunge sport banner that contains a tennis player an american football player and a ice-hockey player over a grunge banner with paint splatters

Desenho de t-shirt com ilustração de bicicleta

T-shirt design featuring a mountain bike rider silhouette against a distressed background

Design de camiseta de basquete de astronauta

Pronto para imprimir

Astronaut basketball t-shirt design featuring an illustration of an astronaut in a space without gravity holding a basketball and about to dunk

Design de camiseta para hóquei no gelo

Pronto para imprimir

Ice Hockey Dabbing T-Shirt Design featuring an ice hockey player celebrating a win with the viral dab dance! Can be used on t-shirts hoodies mugs posters and any other merchandise

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Design de camiseta para bares de ginasta

Pronto para imprimir

Gymnast Mom T-Shirt Design featuring the text My mom lets me hang out at bars

Fundo de futebol da Rússia 2018

Original football background for the 2018 World Cup championship in Russia featuring two transparent players chasing a football ball over Saint Basil's Cathedral silhouette Fondo de futbol original para el campeonato de la Copa del Mundo 2018 en Rusia con dos jugadores transparentes persiguiendo una pelota de futbol sobre la silueta de la Catedral de San Basilio Plano de fundo original do futebol para o campeonato da Copa do Mundo de 2018 na Russia com dois jogadores transparentes perseguindo uma bola de futebol sobre a silhueta da Catedral de Sao Basilio Ursprunglicher Fuballhintergrund fur die Weltmeisterschaft 2018 in Russland mit zwei transparenten Spielern die einen Fuball uber Silhouette der Kathedrale des Heiligen Basilius jagen

Design de camiseta alvo de tiro com arco

Archery Target T-shirt Design with two arrows and a target and the words CALM FOCUSED STEADY NOBLE for the archery niche

Conjunto de silhueta de moto

Collection of 12 motorcycle vehicle silhouettes featuring classic cruiser sport off-road scooter bikes

Design de camisetas de snowboarder

Pronto para imprimir

T-shirt design featuring a snowboarder jumping in the air

Rússia 2018 recebe faixas do estádio

Ilustração Snowboard Heartbeat

Snowboarding design featuring a heartbeat illustration with a person doing snowboard in the middle

Conjunto de emblemas de futebol americano

Collection of american football sports badges in colorful vintage style featuring american football helmet or ball with label and other elements Coleccion de insignias deportivas de futbol americano en estilo vintage colorido con casco o pelota de futbol americano con etiqueta y otros elementos Colecao de emblemas esportivos de futebol americano em estilo vintage colorido com capacete ou bola de futebol americano com etiqueta e outros elementos Sammlung von American-Football-Sportabzeichen im farbenfrohen Vintage-Stil mit American-Football-Helm oder -Ball mit Etikett und anderen Elementen

Design de camiseta para corrida

Pronto para imprimir

Running Sloth T-Shirt Design featuring an illustration of a sloth running with big foot with text that says: Sloth Running Team weAll get there when we get there

Banners de estádios de futebol da Rússia

Conjunto de silhuetas de paraquedas e pára-quedistas

Set of silhouettes featuring different extreme sports like sky diving powered paraglider and more

Design de camiseta para mamãe softball

Pronto para imprimir

Softball Mom T-Shirt Design featuring an illustration of a baseball bat with a bow and a softball ball on the center with lettering around that reads: "Softball Mom"

Silhueta do pacote de windsurf

Collection of windsurfing sport silhouettes

Conjunto de silhueta de futebol americano

Collection of American Football player silhouettes in different positions running standing catching the ball and celebrating a goal

Design alemão de camiseta de handebol

Conteúdo em alemão

Pronto para imprimir

German Handball T-Shirt Design featuring the text Team Germany 2019 with the german flag in the background and sporty player

Pacote de ícones de 37 esportes simples

Set with a lot of sport icons in black and white: uniforms objects balls equipment trophies etc

Design de camisetas com citações de Jiu Jitsu

Pronto para imprimir

Funny T-shirt design featuring two Brazilian Jiu-Jitsu practitioners and the quote SEE YOU IN THE BACK MOUNT

Ilustração do estádio de futebol da copa do mundo

Beautiful football world cup background for the Russia 2018 World Cup championship with a football stadium in front of buildings skyline in red blue and white colors Hermoso fondo de la copa mundial de futbol para el campeonato de la Copa del mundo Rusia 2018 con un estadio de futbol frente al horizonte de edificios en colores rojo azul y blanco Lindo plano de fundo da copa do mundo de futebol para o campeonato da Russia da Copa do Mundo de 2018 com um estadio de futebol em frente ao horizonte dos edificios nas cores vermelho azul e branco Schoner Fuball-Weltcup-Hintergrund fur die Russland-Weltmeisterschaft 2018 mit einem Fuballstadion vor der Skyline des Gebaudes in den Farben Rot Blau und Wei

Ilustração 3D da bola de vôlei

Volleyball design featuring a volley ball in white and yellow over a brown background

Design de camisetas Ping Pong

Pronto para imprimir

Ping Pong T-shirt Design featuring an illustration of a ping pong racket and ball on fire burning

Mascote do Rio 2016 Tom

Rio 2016 Olympics design featuring the illustrated mascot Tom

Banners de estádios da Copa do Mundo 2018

Design de camisetas para caiaque

Pronto para imprimir

Nice kayaking t-shirt design featuring an illustration of a man kayaking on a river he is wearing a cap and a life vest

Sequência de silhuetas de rebatidas de jogadores de beisebol

Sequence of baseball player batting silhouettes

Carro Juke Nissan Preto e Branco

Juke mini sport car manufactured by Nissan Japan in outline mostly with a bit shade touch to the glasses wheels in black and white style artwork

Design de camisetas de sangue frio

Pronto para imprimir

Can be used on t-shirts hoodies mugs posters and any other merchandise

Equipamentos de ginástica e esportes

Different fitness and sport instruments in detail glossy style illustration

de 57

Impulsione seu negóciocom a plataforma gráfica líder para merch