Inscrever-se
Conecte-se
Vexels Logo
All
Pesquisa Aleatória

100 Designs Vetoriais de esquiar para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de esquiar para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados daShutterstock Logo
Ganhe 15% de desconto com o código: VEXELS15

Animais de esqui design de almofadas

para Mercht-shirt icon
Pronto para imprimir
Awesome throw pillow design that features different winter animals skiing in the snow

Design de camiseta de pinguim esquiando

para Mercht-shirt icon
Pronto para imprimir
Cute t-shirt design with an animated penguin enjoying skiing, perfect for winter sport enthusiasts

Design de camiseta com coração de esqui

para Mercht-shirt icon
Pronto para imprimir
Awesome t-shirt design featuring a skier jumping with the quote "My heart burns skiing"

Se você não cair no design de camisetas

para Mercht-shirt icon
Conteúdo em alemão
Pronto para imprimir
Amazing t-shirt design that features a man skiing and the german quote "Wer nicht stArzt fAhrt nicht am limit" (If you don't fall you don't drive to the limit)

Design de camiseta retrô para teleférico

para Mercht-shirt icon
Pronto para imprimir
T-shirt design featuring a cable car in a retro poster style with the text RETRO CABLE CAR

Perseguindo o design frio da camiseta

para Mercht-shirt icon
texto editável
Pronto para imprimir
Amazing t-shirt design that features a bear skiing and the quote "Chasing the cold"

Design de t-shirt da coruja de esqui

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design featuring an own dressed in ski attire

Design de t-shirt de esqui para o Pai Natal

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design featuring an illustration of Santa Claus skiing and carryig a bag full of gifts

Design de caneca de papai esquiador

para Mercht-shirt icon
texto editável
Pronto para imprimir
Action-packed mug design showcasing a vibrant illustration of a skier, perfect for winter sports fans and as a gift for dads who ski

Design de camiseta de esqui de dados de RPG

para Mercht-shirt icon
texto editável
Pronto para imprimir
Fun t-shirt design featuring a role playing dice skiing down a mountain and the quote "Winter roll dices"

Design de camiseta de esqui de porco louco

para Mercht-shirt icon
Pronto para imprimir
Amazing t-shirt design that features a pig cartoon skiing

Design de camiseta de esqui nórdico

para Mercht-shirt icon
texto editável
Pronto para imprimir
Intriguing t-shirt design with a Nordic deity motif merged with a skiing theme, and the text "Pray for Snow"

Design de camiseta com silhueta de biatleta vitruviano

para Mercht-shirt icon
Pronto para imprimir
Conceptual t-shirt design with a Vitruvian man-inspired biathlete silhouette

Conjunto de design de distintivo de esqui

Premiumcrown icon
Amazing badge design set that features different skiing badges with quotes such as "Let it snow" "Skiing life" "Ski on" and more! Enjoy! Increible conjunto de diseno de insignias que presenta diferentes insignias de esqui con citas como "Let it snow", "Skiing life", "Ski on" y mas! Disfrutar! Incrivel conjunto de design de crachas que apresenta diferentes crachas de esqui com citacoes como "Deixe nevar" "Vida de esqui" "Esquiar" e muito mais! Aproveitar! Erstaunliches Abzeichen-Design-Set mit verschiedenen Ski-Abzeichen mit Zitaten wie Let it snow, Skiing life, Ski on und mehr! Genieen!

Pessoas se exercitando com conjunto de animais de cães

Premiumcrown icon
Amazing animal-themed set that features several people doing different sports with dogs, such as running, using a bike and skiing

Conjunto de equipamento de esqui preto e branco

Premiumcrown icon
Incredible collection of ski equipment design elements featuring boots gloves glasses helmet ski poles and more

Coleção de silhuetas esportivas

Huge collection of various sports silhouettes

Design colorido de esqui

This beautiful and colorful design show a man skiing making a jump

Conjunto de ilustração de pessoas esquiando

Premiumcrown icon
Amazing illustration set in black and white featuring multiple people in different skiing positions

Silhuetas de pessoas esquiando conjunto de inverno

Premiumcrown icon
Amazing sport-themed set that features a series of silhouettes of people skiing in different extreme poses

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

40 silhuetas de esportes de inverno

This is a big set with 40 silhouettes related to winter sports: skiing snowboarding ice skating hockey snowmobile racing etc

6 emblemas de esportes radicais

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Grande conjunto de personagens de desenhos animados de Natal

Merry Christmas dudes! This is a huge set of Christmas cartoon characters that includes Santa Claus children elf reindeer Christmas elements and much more

Conjunto de silhueta de esquiadores

Premiumcrown icon
Amazing set design that features various people skiing in different positions all in silhouette style

Conjunto de elementos de ícone de esporte de inverno de esqui

Premiumcrown icon
Amazing winter sport-themed set that features different ski equipment such as goggles, gloves, skiis and more! Each one can be used individually

Conjunto de silhueta de esportes de inverno

Premiumcrown icon
Cool silhouette set design that features people doing different winter sports like snowboarding and skiing

Esporte de inverno de esqui com conjunto de silhueta

Premiumcrown icon
Awesome sport-themed set that features a series of silhouettes of people skiing in extreme poses

Conjunto de design de cenas de esqui

Premiumcrown icon
Beautiful illustration set that includes four different ski scenes featuring a snowboard ski lifts skis and more! Each design can be used separately

Flat Minimal Sports Icon Pack

Flat and minimal style set of 20 different sporting icons in black color

3 etiquetas de esportes de esqui

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Conjunto de ilustração de par de esqui colorido

Premiumcrown icon
Illustration set featuring various pairs of skis of different sizes shapes and colors

Conjunto de elementos de equipamento de esqui

Premiumcrown icon
Collection of ski equipment design elements featuring boots

Esquie na Snowy Mountain

Cool illustration of a snowy mountain landscape with a guy skiing and mountain cabin

Design de capa de livro de esporte de atleta de esqui

Premiumcrown icon
texto editável
Pronto para imprimir
Amazing book cover design featuring a person doing a cool skiing trick

Man Jumping Mountain Skiing

Extreme sports concept background representing a man skiing on the mountain by jumping in the air through the snow holding ski poles

Coleção Winter People Simple Stroke Design

Premiumcrown icon
People design collection featuring people in different winter activities

Design de ilustração de esqui de montanha

Cool sports themed design featuring an illustration of a man skiing wearing grey jacket and red pants on a snowy mountain landscape

Design de óculos de esqui de montanha

Graphic design of snow goggles with a mountain reflected on its surface

Design de padrão do Colorado para esporte de esqui

Premiumcrown icon
padrão tileable
Great pattern design depicting elements related to colorado state, such as the flag, beer and skiing

Conjunto de elementos coloridos da Noruega desenhados à mão

Premiumcrown icon
Colored elements set featuring various Norway elements in illustrated style

Pacote de elementos desenhados à mão da Noruega

Premiumcrown icon
Elements design pack featuring various Norway hand drawn elements

Padrão temático de esqui de inverno

Nice seamless seasonal winter pattern featuring winter clothing snowflakes and mountain icons

Design de padrão de personagens de animais de inverno

Premiumcrown icon
padrão tileable
Amazing pattern design that features cute winter animals skiing and snow

Pacote de Design de Ícones de Traço da Suíça

Premiumcrown icon
Icon design pack featuring various Swiss icons in stroke style

Conjunto de férias de inverno para animais

Premiumcrown icon
Cute flat style vector set featuring six animals with winter clothes in different holidays activities

Animais para férias de inverno

Premiumcrown icon
Cute Winter set featuring a stroke style polar bear a fox and a raccoon in different holidays activities

Ilustração plana de cena de neve de inverno

Premiumcrown icon
Flat illustration of a winter snowy scene featuring people in different activities and the quote TIME FOR WINTER

Vetor de esportes

Sports vector design in encapsulated postscript

ilustração de montanha homem esquiando

Beautiful illustration design of a snowy mountain pine trees and a guy skiing on a sunny day
Impulsione seu negóciocom a plataforma gráfica líder para merch
VER PLANOS