Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

425 Designs Vetoriais de hiking para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de hiking para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Seeker man illustration

Não encontramos nenhum hiking Vetores, mas aqui estão todos os nossos hiking designs ou solicitar design aqui

Design elegante com estampa tribal de botas Desenho PNG

Unique boot print design showcases intricate tribal patterns for footwear aesthetics

Ilustração divertida de uma caneca de acampamento com desenho de árvore. Desenho PNG

Charming illustration featuring a yellow camping mug with a tree symbol, highlighting outdoor adventure themes

Design de candeeiro a óleo com ilustração de paisagem montanhosa. Desenho PNG

Charming illustration in a lantern showing mountains and a sun motif

projeto de tirolesa para esportes de aventura Desenho PNG

Dynamic t-shirt design featuring a silhouette of a zipliner amidst scenic hills and a stylized sunset

Ilustração encantadora de botas de inverno Desenho PNG

Playful graphic design of winter boots featuring fluffy cuffs and buckles

Lanterna colorida com desenho de paisagem cênica Desenho PNG

Charming illustration of a camping lantern featuring a serene mountain landscape and river inside

Design de camiseta com citação do parque nacional olímpico

Pronto para imprimir

Awesome t-shirt design featuring pine trees over a mountain and the quote "Winter hiking warms my soul"

Ilustração de botas arrojadas em estilo militar Desenho PNG

Bold illustration of combat boots featuring intricate lacing and detailed textures

Ícones e elementos de acampamento

Camping is one big way of enjoy life outdoors

Paisagem plana de lago de montanha

Beautiful mountains landscape with turquoise lake pine tree forest hills cloudy sky snowed peaks and aero-static globe

Design de camisetas Mountain Love

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Ilustração detalhada de uma lanterna com paisagem montanhosa. Desenho PNG

Unique lantern design featuring a scenic mountain landscape inside

Design de camisetas para Boy on Rock Landscape

Pronto para imprimir

T-shirt design featuring a boy on top of a rock holding a balloon

Vamos obter um design de camisetas realmente alto

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Design gráfico divertido para calçados Desenho PNG

Whimsical design featuring stylized legs in boots, creating a fun and quirky look

Design de camiseta Stroke mountain

Cool mountain theme t-shirt design featuring stroke lines looking like mountain over grunge stripes backdrop

Ilustração de bota vintage estilosa Desenho PNG

Unique vintage boot design showcasing intricate lacing and detailed contours

Ilustração de botas de inverno aconchegantes Desenho PNG

Charming illustration of winter boots, featuring a soft fur top and detailed laces

Ilustração de paisagem montanhosa de inverno

Flat illustration featuring a field with some trees and mountains on the horizon

Paisagem plana de floresta montanhosa

Flat landscape illustration featuring lots of mountains and woods

Mountain Calling T-shirt Design

Cool t-shirt design showing a badge with mountains illustration and "Mountains Are Calling" caption

Design elegante com pegada vermelha Desenho PNG

Dynamic footprint design featuring bold red soles and striking star patterns

Sempre um design de camiseta de alpinista

Pronto para imprimir

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Venha comigo t-shirt design

Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

Conjunto de ícones de silhueta de montanha

Mountain icon set featuring 16 mountain designs in silhouette style

Ilustração detalhada de uma bota de combate. Desenho PNG

Sturdy boot design featuring intricate lacing details and a robust style

Paisagem florestal com árvores altas

Illustration featuring a pine tree forest viewed from the ground

Ícone de silhueta de alpinismo Desenho PNG

Ícone de silhueta de alpinismo

Projeto de paisagem de montanha plana

Flat winter landscape illustration featuring lots of mountains snow and woods

Montanhas aguardam design de camisetas

Cool Black and white T-shirt design with a mountain over the clouds illustration

Conjunto de ilustração de montanha isolada

Set of mountain illustrations in different shapes and tones

Crachás de acampamento

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Projeto de paisagem de natureza plana

Flat landscape illustration featuring lots of hills fields and woods

Paisagem de floresta verde com veados

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Conjunto de ilustrações isoladas de montanhas

Set of mountain illustrations in different tones and shapes

Ilustração de paisagem de floresta plana

Flat landscape illustration featuring a forest mountain and river

Ilustração de paisagem de campo calmo

Flat illustration featuring a field with some hills on the horizon

Identificação do vetor comum prático

Identification of practical common vector image in

Paisagem de inverno com neve e árvores

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Ilustração de paisagem de acampamento com fogueira

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Paisagem de floresta e montanhas com veados

Flat landscape illustration featuring lots of trees mountains and a deer

Coleção de silhuetas esportivas

Huge collection of various sports silhouettes

Ilustração de montanha com neve

Flat winter landscape illustration featuring lots of mountains snow and some woods

Kit de sobrevivência para acampamento

This amazing set of camping survival kit has a collection of the most important elements for camping and hiking world

A aventura espera o design de camisetas para experiências ao ar livre

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Ilustração do nascer do sol nas montanhas

Low poly illustration featuring moutains and the sun rays coming through them

Paisagem da ilustração do pôr do sol da floresta

Flat landscape illustration featuring a forest with light coming through the tree branches

Um com o design da camiseta das montanhas

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Projeto de ilustração de paisagem de montanha

Flat illustration featuring moutains and their reflection

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

de 9

Impulsione seu negóciocom a plataforma gráfica líder para merch