Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

424 Designs Vetoriais de hiking para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de hiking para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Seeker man illustration

Não encontramos nenhum hiking Vetores, mas aqui estão todos os nossos hiking designs ou solicitar design aqui

Design de rótulo de garrafa em estilo vintage Desenho PNG

Playful badge design featuring a vintage-style bottle with artistic details and iconography

projeto de tirolesa com tema de aventura Desenho PNG

Dynamic poster design featuring a silhouetted zipliner amidst trees and mountains

Um com o design da camiseta das montanhas

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Ilustração de frasco de poção em estilo vintage Desenho PNG

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Design de camisetas Mountain Love

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Silhueta de mochileiro com pôr do sol e paisagem de montanha em estampa de camiseta Desenho PNG

Dynamic illustration featuring a hiker against stylized mountains and sun

Ilustração de paisagem montanhosa de inverno

Flat illustration featuring a field with some trees and mountains on the horizon

Vamos obter um design de camisetas realmente alto

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Design de camisetas para Boy on Rock Landscape

Pronto para imprimir

T-shirt design featuring a boy on top of a rock holding a balloon

Crachás de acampamento

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Design de camiseta Stroke mountain

Cool mountain theme t-shirt design featuring stroke lines looking like mountain over grunge stripes backdrop

Logotipo da montanha vintage Desenho PNG

Logotipo da montanha vintage

Design exclusivo da garrafa com motivo de montanha Desenho PNG

Design de camiseta com silhueta de aventura dinâmica na montanha Desenho PNG

Dynamic climbing illustration featuring a climber against a mountain backdrop

Conjunto de ilustrações isoladas de montanhas

Set of mountain illustrations in different tones and shapes

Paisagem plana de floresta montanhosa

Flat landscape illustration featuring lots of mountains and woods

Montanhas aguardam design de camisetas

Cool Black and white T-shirt design with a mountain over the clouds illustration

Paisagem florestal com árvores altas

Illustration featuring a pine tree forest viewed from the ground

Identificação do vetor comum prático

Identification of practical common vector image in

Venha comigo t-shirt design

Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

Sempre um design de camiseta de alpinista

Pronto para imprimir

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Design de garrafa divertido em estilo vintage Desenho PNG

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Design de camiseta com citação do parque nacional olímpico

Pronto para imprimir

Awesome t-shirt design featuring pine trees over a mountain and the quote "Winter hiking warms my soul"

Design gráfico de silhueta de aventura com montanhas e sol. Desenho PNG

Vibrant poster design featuring a hikers silhouette against a scenic mountain backdrop

Projeto de paisagem de montanha plana

Flat winter landscape illustration featuring lots of mountains snow and woods

Conjunto de ilustração de montanha isolada

Set of mountain illustrations in different shapes and tones

Coleção de silhuetas esportivas

Huge collection of various sports silhouettes

Ilustração vintage de uma garrafa de água para camping com elementos da natureza. Desenho PNG

Projeto de paisagem de natureza plana

Flat landscape illustration featuring lots of hills fields and woods

Paisagem de floresta verde com veados

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Ícones e elementos de acampamento

Camping is one big way of enjoy life outdoors

Ilustração estilizada de garrafa vintage Desenho PNG

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Ilustração de paisagem de floresta plana

Flat landscape illustration featuring a forest mountain and river

Ilustração de paisagem de campo calmo

Flat illustration featuring a field with some hills on the horizon

Paisagem plana de lago de montanha

Beautiful mountains landscape with turquoise lake pine tree forest hills cloudy sky snowed peaks and aero-static globe

Ilustração de acampamento plana

Flat illustration featuring a camping on a forest with a tent campfire and other details

Paisagem de inverno com neve e árvores

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Ilustração de paisagem de acampamento com fogueira

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Paisagem de floresta e montanhas com veados

Flat landscape illustration featuring lots of trees mountains and a deer

A aventura espera o design de camisetas para experiências ao ar livre

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Ilustração de montanha com neve

Flat winter landscape illustration featuring lots of mountains snow and some woods

Paisagem de montanha

Illustrated nature landscape featuring mountains trees and clouds

Kit de sobrevivência para acampamento

This amazing set of camping survival kit has a collection of the most important elements for camping and hiking world

Mountain Calling T-shirt Design

Cool t-shirt design showing a badge with mountains illustration and "Mountains Are Calling" caption

Ilustração do nascer do sol nas montanhas

Low poly illustration featuring moutains and the sun rays coming through them

Paisagem da ilustração do pôr do sol da floresta

Flat landscape illustration featuring a forest with light coming through the tree branches

Projeto de ilustração de paisagem de montanha

Flat illustration featuring moutains and their reflection

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Ilustração de paisagem de floresta com neve

Flat illustration featuring a forest with falling snow and bokeh

Design de camisetas Tudo para você

Pronto para imprimir

Nice t-shirt design featuring an illustration of couples mountain climbing with "I do everything for you" caption

Impulsione seu negóciocom a plataforma gráfica líder para merch