Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

7693 Modelos de Mockup PSD de esporte para Photoshop

Baixar Modelos Editavéis de Mockup PSD de esporte

Você quis dizer: esports ?

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Seeker man illustration

Não encontramos nenhum esporte PSD, mas aqui estão todos os nossos esporte designs ou solicitar design aqui

Design de camiseta de patinação artística

Beautiful ice skating t-shirt design featuring silhouette of woman performing Biellmann spin figure skating element with a spiral line around her and "Born to Ice Skate" caption Hermoso diseno de camiseta de patinaje sobre hielo con la silueta de una mujer que realiza el elemento de patinaje artistico de giro Biellmann con una linea en espiral a su alrededor y la leyenda "Born to Ice Skate" Lindo design de camiseta de patinacao no gelo com a silhueta de uma mulher realizando um elemento de patinacao artistica em rotacao de Biellmann com uma linha espiral ao redor dela e a legenda "Born to Ice Skate" Wunderschones Eislauf-T-Shirt-Design mit der Silhouette einer Frau die ein Biellmann-Spin-Eiskunstlaufelement mit einer Spirallinie um sie herum und der Beschriftung "Born to Ice Skate" ausfuhrt

Ilustração Snowboard Heartbeat

Snowboarding design featuring a heartbeat illustration with a person doing snowboard in the middle

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Design de boxe com silhuetas

Boxing design featuring colorful silhouettes of people throwing punches

Design de camiseta de unicórnio musculoso

Pronto para imprimir

A funny t-shirt design featuring a muscular unicorn with pink back drop and a tiny colorful stars around him

Design de camisetas de futebol americano

Nice sports t-shirt design featuring six american football balls with different designs in blue and yellow color grouped by three and "American football" caption between them Bonito diseno de camiseta deportiva con seis balones de futbol americano con diferentes disenos en color azul y amarillo agrupados por tres y la leyenda "Futbol americano" entre ellos Belo design de camiseta esportiva com seis bolas de futebol americano com designs diferentes em azul e amarelo agrupados por tres e a legenda "Futebol americano" entre elas Schones Sport-T-Shirt-Design mit sechs American-Football-Ballen mit verschiedenen Designs in blauer und gelber Farbe gruppiert nach drei und "American-Football" -Zeichen zwischen ihnen

Fabricante de logomarca de futebol

Design de camisetas Bull Boxer

Pronto para imprimir

Cool imaginary t-shirt design features a boxer in guard pose with head of a bull

Criador da etiqueta do logotipo do time de futebol

Design de camiseta masculina Running

Pronto para imprimir

Running Men T-Shirt Design featuring some men running a marathon with the phrase Just Keep Going

Design de camisetas para ioga

texto editável

Pronto para imprimir

Yoga Quote T-Shirt Design featuring lettering that reads "Yoga" on top and "Mind + Body + Spirit"

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Banners de boxe hóquei e sinuca

Grungy set of 3 banners with paint splatters and distinctive elements of each sport or game

Conjunto de silhuetas de paraquedas e pára-quedistas

Set of silhouettes featuring different extreme sports like sky diving powered paraglider and more

Logotipo da bola de tênis amarelo e verde Desenho PNG

Design de t-shirt Kick Boxing

Pronto para imprimir

Kick Boxing T-Shirt design featuring an illustration of a fist punching to the front and two letterings

Design de camisetas para esportes radicais de motocross

T-shirt design featuring a motocross silhouette jumping across the sky

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Design de camiseta de futebol e cerveja

Pronto para imprimir

Cool t-shirt design featuring an illustration of a beer glass and a soccer ball with the caption "Fussball & bier das lob ich mir" Can be used on t-shirts hoodies mugs posters and any other merchandise

Conjunto de silhueta de futebol americano

Collection of American Football player silhouettes in different positions running standing catching the ball and celebrating a goal

Design de camiseta com citações de tiro com arco

Archery Quote T-shirt Design featuring a quote related to the archery niche saying "SOME SAY LIVE LAUGH LOVE I SAY RAISE AIM SHOOT"

Caminhada Forest T-Shirt Design

Pronto para imprimir

Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Design grunge esportivo

Grunge sport banner that contains a tennis player an american football player and a ice-hockey player over a grunge banner with paint splatters

Desenho de t-shirt com ilustração de bicicleta

T-shirt design featuring a mountain bike rider silhouette against a distressed background

Botas para design de camisetas de caminhada

Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Design de camisetas para jogadores de hóquei

Pronto para imprimir

T-shirt design featuring hockey players' silhouettes

Design de camiseta Turbocharger illustraiton

Pronto para imprimir

Amazing t-shirt design that features a tribal sport illustration

Logo do time de futebol do Irã Desenho PNG

Logotipo ilustrado do boxe

Design de camiseta T-Rex de tênis

Pronto para imprimir

Tennis T-Rex T-Shirt Design featuring a Dinosaur playing a Tennis match having some trouble with his short arms! Can be used on t-shirts hoodies mugs posters and any other merchandise

Design de camiseta para caminhadas e aventura na vida

Pronto para imprimir

Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Design de camisetas de skate

Pronto para imprimir

Skateboarding t-shirt design featuring a skater silhouette jumping across the sky

Ilustração do estádio de futebol da copa do mundo

Beautiful football world cup background for the Russia 2018 World Cup championship with a football stadium in front of buildings skyline in red blue and white colors Hermoso fondo de la copa mundial de futbol para el campeonato de la Copa del mundo Rusia 2018 con un estadio de futbol frente al horizonte de edificios en colores rojo azul y blanco Lindo plano de fundo da copa do mundo de futebol para o campeonato da Russia da Copa do Mundo de 2018 com um estadio de futebol em frente ao horizonte dos edificios nas cores vermelho azul e branco Schoner Fuball-Weltcup-Hintergrund fur die Russland-Weltmeisterschaft 2018 mit einem Fuballstadion vor der Skyline des Gebaudes in den Farben Rot Blau und Wei

Design de t-shirt do emblema do surf

T-shirt design featuring a surfer silhouette among the waves

Design de camiseta de escalada de Utah

Pronto para imprimir

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Banners de estádios da Copa do Mundo 2018

Fundo de futebol da Rússia 2018

Original football background for the 2018 World Cup championship in Russia featuring two transparent players chasing a football ball over Saint Basil's Cathedral silhouette Fondo de futbol original para el campeonato de la Copa del Mundo 2018 en Rusia con dos jugadores transparentes persiguiendo una pelota de futbol sobre la silueta de la Catedral de San Basilio Plano de fundo original do futebol para o campeonato da Copa do Mundo de 2018 na Russia com dois jogadores transparentes perseguindo uma bola de futebol sobre a silhueta da Catedral de Sao Basilio Ursprunglicher Fuballhintergrund fur die Weltmeisterschaft 2018 in Russland mit zwei transparenten Spielern die einen Fuball uber Silhouette der Kathedrale des Heiligen Basilius jagen

Anti conjunto de distintivos de desenho animado do dia dos namorados

Funny anti valentines day badge set that features quotes such as "Cause of death: drama" and "Ghosting is my favorite sport"

Rússia 2018 recebe faixas do estádio

Carro Juke Nissan Preto e Branco

Juke mini sport car manufactured by Nissan Japan in outline mostly with a bit shade touch to the glasses wheels in black and white style artwork

Silhueta do pacote de windsurf

Collection of windsurfing sport silhouettes

Banners de estádios de futebol da Rússia

Equipamentos de ginástica e esportes

Different fitness and sport instruments in detail glossy style illustration

Pacote de ícones de 37 esportes simples

Set with a lot of sport icons in black and white: uniforms objects balls equipment trophies etc

Ilustração 3D da bola de vôlei

Volleyball design featuring a volley ball in white and yellow over a brown background

Logotipo da bola de tênis amarela Desenho PNG

Mascote do Rio 2016 Tom

Rio 2016 Olympics design featuring the illustrated mascot Tom

Sequência de silhuetas de rebatidas de jogadores de beisebol

Sequence of baseball player batting silhouettes

Águia de desenho animado segurando uma bola de futebol Desenho PNG

A playful cartoon eagle holds a football in its talons, showing its love for the sport with a mischievous smile on its face

É dia de jogo SVG Desenho PNG

An SVG image depicting the excitement of game day, with vibrant colors, cheering fans, and sports-related elements

Impulsione seu negóciocom a plataforma gráfica líder para merch