Inscrever-se
Conecte-se
Vexels Logo
All
Pesquisa Aleatória

122 Vetores e Gráficos de escalada para Baixar

Baixar gráficos vetoriais editáveis de escalada para tudo projeto de design. Em AI, SVG, PNG, JPG e PSD.

Resultados patrocinados daShutterstock Logo
Ganhe 15% de desconto com o código: VEXELS15

Conjunto de esportes de silhuetas de escalada de pessoas

Premiumcrown icon
Pronto para imprimir
Awesome sport-themed set that features a series of silhouettes of people climbing

Padrão sem emenda de parede de escalada

Premiumcrown icon
padrão tileable
Cool seamless pattern that resembles a rock climbing wall

Ilustração de quadro de escalada de playground

Premiumcrown icon
Colorful kids playground illustration of play towers with slides and climbing frame

Metáfora de motivação de escalada

Rock climbing girl with beautiful twilight sundown on the background

Cordas de equipamento de escalada e conjunto de passatempo de nozes

Premiumcrown icon
Awesome hobby-themed set that features a series of climbing equipment in blue, red, purple, orange and green

Conjunto de silhueta de escalada

Awesome set design that features four people climbing in silhouette style

Pôster de homem que escalou montanha

This poster shows the silhouette of a man climbing a mountain with other mountains covered in snow behind him

Escalada design colorido

This vectors shows a young man climbing  on a limesonte wall with colorful abstract design

Conjunto de ícones de silhueta de montanha

Mountain icon set featuring 16 mountain designs in silhouette style

Crachás de acampamento

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Emblemas de logotipos de acampamento retrô e emblemas de caminhada

Set of 9 nice retro Logo Badges to use for outdoors activities like hiking camping mountaineering climbing and nature adventure

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Modelo de crachá de rótulo de montanha

Label or badge design featuring a mountain silhouette in tones of green and blue

6 modelos de logotipo de distintivo de montanha

Set of mountain labels or badges

Conjunto de silhuetas de pessoas para caminhadas e escaladas

Premiumcrown icon
People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Conjunto de silhuetas de alpinismo

Mountain climbing silhouettes set

Conjunto de modelo de logotipo de distintivo de montanha

Label or badge designs featuring mountain silhouettes and slogans

Design de camiseta de alpinismo

Premiumcrown icon
T-shirt design featuring the silhouette of someone climbing a mountain

Poses de bombeiro de ação

Various vector designs in this set depicting a fireman in action poses

Emblemas de etiqueta retrô para caminhadas e camping

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

Clip-art de Rock Mountain ou Hill Climibing

Abstract black and white style artwork of a male character climbing rock mountain

6 emblemas de esportes radicais

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Ilustração de Mountain Hearbeat

Mountain Heartbeat design featuring a heartbeat illustration with a mountain in the middle

Ilustrações de férias de inverno na montanha

Set of illustrations featuring people doing alpinism and climbing mountains

Modelo de logotipo moderno da montanha

Label or logo template design featuring a mountain silhouette in tones of blue and gray

Banners de mergulho e alpinismo

Flat silhouette style of banners: diving and alpinism in plain colors

Modelo de logotipo abstrato de montanha

Abstract mountain logo template design featuring a blue mountain

Montanha Trekking Masculina

Beautiful looking picture depicts a couple of men trekking mountains over abstract colorful sunrise sky in the background

Pacote de ilustrações de acampamento

Set of two camping illustrations featuring forest and mountain landscapes

Design do modelo do logotipo do emblema da montanha

Mountain logo template design featuring a mountain silhouette over a yellow sun

2 faixas ou quadros de ilustração de montanha ao ar livre

Set of two illustrations featuring forest and mountain landscapes

Modelo de design de logotipo de montanha abstrato

Label or logo design featuring a mountain silhouette in tones of blue and gray

Alpinismo mulher design

This vector shows the silhouette of a woman doing alpinism with some mountains covered in snow behind her

28 ícones quadrados de silhuetas de esportes

This set has 28 icons of many different sports represented as silhouettes within yellow squares

Conjunto de ilustrações de acampamento

Set of two camping illustrations featuring forest and mountain landscapes

Conjunto de acampamento ilustrado

Set of two camping illustrations featuring mountain and forest landscapes

Conjunto de ilustração de paisagens ao ar livre

Premiumcrown icon
Set of two illustrations featuring a forest and icy mountain landscape

30 ícones do círculo de esporte

This set has 30 icons of many different sports represented as silhouettes within colored circles

Esportes

Sports Deportes Esportes Sport

Modelo de logotipo de rótulo de montanha

Label or logo design featuring a mountain silhouette in red tones

20 ícones de elementos de inverno

Here you have 20 icons related to winter season: snowflake shapes winter clothes transport and sports etc

Fundo de fotos de viagens de férias

Background with several photos of landmarks and landscapes around the world   placed over a parchment

2 banners ou quadros de ilustração de floresta ao ar livre

Set of two camping illustrations featuring forest landscapes

Homem subindo escadas sequência de silhuetas de quadros

Man climbing stairs sequence frames silhouettes

Design do logotipo da etiqueta da montanha

Label design featuring a mountain silhouette in green tones

Rapariga escaladora excitante

Freaky hot Climbing girl

Fotojornalista com fotos ao redor do mundo

Female photojournalist with pictures around the world

Pacote de personagens para crianças brincando

Premiumcrown icon
Character pack featuring 4 kids playing and doing different activities

Design do modelo do logotipo da montanha

Label or logo design featuring a mountain silhouette in tones of green and gray

Design do modelo do logotipo da etiqueta da montanha

Label logo or badge design featuring a mountain silhouette in red tones
Impulsione seu negóciocom a plataforma gráfica líder para merch
VER PLANOS