Inscrever-se
Conecte-se
Vexels Logo

1860 Vetores e Gráficos de silhuetas para Baixar

Baixar gráficos vetoriais editáveis de silhuetas para tudo projeto de design. Em AI, SVG, PNG, JPG e PSD.

Resultados patrocinados daShutterstock Logo
Ganhe 15% de desconto com o código: VXL15

Coleção de silhuetas de fotógrafo

Collection of isolated photographers shooting photos silhouettes in different poses

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Conjunto de silhueta de pessoas dançando linha

Premiumcrown icon
Check this cool figures set including different people performing line dance! The elements of this set can be isolated for individual use! Mira este genial conjunto de figuras que incluye a diferentes personas bailando en linea! Los elementos de este conjunto se pueden aislar para uso individual! Confira este conjunto de figuras legais, incluindo diferentes pessoas realizando danca de linha! Os elementos deste conjunto podem ser isolados para uso individual! Schauen Sie sich dieses coole Figurenset mit verschiedenen Personen an, die Line Dance auffuhren! Die Elemente dieses Sets konnen zur individuellen Verwendung isoliert werden!

Silhueta fazendo design de camiseta de calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Fun t-shirt design featuring a person exercising and the quote "Never give up only pull up"

Sequência de silhuetas de rebatidas de jogadores de beisebol

Sequence of baseball player batting silhouettes

Silhuetas de ajuda do Dia Global dos Beatles

Great poster for Global Beatles Day featuring the Help silhouettes in multiple colors over black background

Coleção de silhuetas em ferradura

Collection of eight isolated horseshoes silhouettes with different design

Silhuetas de pessoas no estilo grunge

Premiumcrown icon
Set of people silhouettes in various sporting and dancing positions

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Conjunto de corte de pessoas soprando vidro

Premiumcrown icon
Check out this cool cut-out set of people making blown glass objects! Each character of this set can be separated for individual use

Coleção de silhuetas de músicos

Big set of musicians silhouettes featuring musicians playing guitar drums singing and more

Design de modelo de caneca de treino de calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Cool mug template featuring a person doing calisthenics and the quote "Just one more rep"

160 silhuetas de animais

Here is a big set with 160 silhouettes of domestic farm and wild animal species

Silhuetas de poses de ioga

Collection of men and women doing yoga poses silhouettes

Design de camiseta de silhueta de esporte de calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Cool t-shirt design featuring a person doing a pull up and the quote "Push up, pull up, muscle up"

Conjunto de silhuetas de carros e caminhonetes

Collection of silhouettes featuring different cars pickup trucks station wagons and more

Silhuetas de pássaros voando

Flying bird motion silhouettes

Design de t-shirt de evolução do tênis de padel

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design that features the paddle tennis evolution in silhouette style

Design de camiseta de força esportiva de calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Awesome t-shirt design featuring a person doing calisthenics and the quote "My body my gym"

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Ilustração de silhuetas de amizade

Colorful silhouettes of kids running around under the word friendship in capital letters

Design de camisetas de animais da floresta

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt adorned with a colorful design featuring a deer, bear, eagle, and fox, showcasing his love for nature and wildlife

Homem fazendo pull ups calistenia design de t-shirt

para Mercht-shirt icon
texto editável
Pronto para imprimir
Awesome t-shirt design featuring a man doing pulls ups and the quote "Pull up and shut up"

46 silhuetas de meninas dançando

Set of 46 girl dancers silhouettes in different positions and dancing styles

Conjunto de silhuetas de símbolos africanos de Adinkra

Silhouette set featuring numerous African Adrinka symbols

Conjunto de silhueta de evolução do artista

Premiumcrown icon
Cool silhouette set design that features the evolution of a paint artist

Pessoa exercitando design de camiseta de calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Cool t-shirt design featuring a person exercising and the quote "Just one more rep"

Silhuetas de meninas dançando em vetor grátis

Unique collection 32 silhouettes of dancing girls

Conjunto de silhueta de pessoas dançando pop

Premiumcrown icon
Awesome hobby-themed set that features a series of people dancing in different ways in silhouette style

Design de camiseta de evolução do grill

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design that features the grill man evolution

Design de camiseta com citação de esporte de calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Amazing t-shirt design featuring the quote "Strong without weights"

Conjunto de silhuetas de cavalos

Premiumcrown icon
Huge collection of horse silhouettes in different postures and activities

Design de camiseta de silhueta T-rex

para Mercht-shirt icon
texto editável
Pronto para imprimir
Cool t-shirt design featuring the word "T-Rex", surrounded with sikhouettes of t-rex dinosaurs

Design de camiseta com citação de fitness calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Cool t-shirt design featuring the quote "My warm up is your workout"

Coleção de silhuetas de bebês

Big set of silhouettes featuring babies in different poses and postures

Irmãs jogando design de camiseta

para Mercht-shirt icon
Pronto para imprimir
Look at this cool t-shirt design of two sisters playing on a swing by a tree

Homem fazendo design de sacola de calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Amazing tote bag design featuring a person doing calisthenics and the quote "Turn off gravity"

Violino formado por design de t-shirt de notas musicais

para Mercht-shirt icon
Pronto para imprimir
Cool t-shirt design that features a violin silhouette formed by musical notes

Conjunto de silhuetas de dançarinas de Lindy Hop

Big set of silhouettes featuring Lindy Hop dancers in different poses and postures

Design de camiseta de força de núcleo esportivo de calistenia

para Mercht-shirt icon
texto editável
Pronto para imprimir
Awesome t-shirt design featuring a person doing calisthenics and the quote "No gravity club"

Conjunto de silhuetas de soldados do exército

Army Soldiers Action Silhouette Set featuring various soldier silhouettes in running actions

Silhuetas de dançarina de flamenco

Big set of silhouettes featuring flamenco dancers in different poses and postures

Mantenha o design de camiseta de meditação focado

para Mercht-shirt icon
Pronto para imprimir
Check this great meditation t-shirt design including a meditating woman's silhouette in a retro sunset background and the quote 'Negativity spreads between minds like locusts

Coleção de silhuetas de crianças

Collection of toddler silhouettes featuring sitting standing playing baby and children silhouettes

Silhuetas de dançarina do ventre

Big set of silhouettes featuring belly dancers in different poses and postures

Horizonte de Nova York com silhuetas

Illustration featuring a New York skyline with silhouettes of classic buildings and cultural landmarks

Horizonte de Paris com silhuetas

Illustration featuring a Paris skyline with silhouettes of classic buildings and cultural landmarks

Cavalo correndo silhuetas de quadros de sequência

Horse running sequence frames silhouettes

Conjunto de silhuetas de dança africana

Collection of 4 silhouettes featuring traditional African dance moves

Conjunto de 20 silhuetas de rugby

Set with 20 silhouettes of rugby players doing different moves kicking the ball fighting for it running jumping etc
Impulsione seu negóciocom a plataforma gráfica líder para merch
VER PLANOS