Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

4486 Gráficos e Designs de e sport para Camisetas e Merch print on demand

Baixar designs de camisetas e para merch, como capas de livro, capas de celular, tote bags e mais de e sport

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VEXELS15

Caminhada design de camiseta com citação alemã

ConteÃºdo em alemÃ£o

Pronto para imprimir

Cool t-shirt design featuring the quote in German "Mehr wandern weniger sorgen" (More hiking less worries)

Conjunto de silhueta feminina de handebol

Nice silhouette set featuring six female handball players in different postures

Design de t-shirt Kick Boxing

Pronto para imprimir

Kick Boxing T-Shirt design featuring an illustration of a fist punching to the front and two letterings

Logotipo da tipografia Palms Sun Beach

Conjunto de 6 bolas de rugby

These are just 6 rugby balls in different colors and styles

Design de camiseta de esqueleto de academia

texto editÃ¡vel

Pronto para imprimir

Cool t-shirt design featuring a retro cartoon skeleton lifting gym weights, with the quote "PR or ER"

Design de camiseta de unicórnio de karatê bonito

Pronto para imprimir

Cool t-shirt design that features a unicorn doing karate and the quote "Sweet but dangerous"

Esqueleto com design de t-shirt de luvas de boxe

Pronto para imprimir

Amazing t-shirt design that features a skeleton punching with boxing gloves and the quote "Boom"

Animal tigre jogando basquete design de camiseta

Pronto para imprimir

Cool t-shirt design featuring a tiger playing basketball

Design de t-shirt de graffiti de basquete

Pronto para imprimir

Awesome t-shirt design featuring a cartoon basketball with the quote "I'm a hooper" in graffiti style

Design engraçado de t-shirt com citações de bilhar alemão

ConteÃºdo em alemÃ£o

Pronto para imprimir

T-shirt design featuring a funny design about the game of billiards and a quote in German saying BIN ICH DRAN? - HINSETZTEN! ZU GUCKEN! LERNEN! (IS IT MY TURN? SIT DOWN! WATCH! LEARN!) Use this print ready design for t-shirts posters mug hoodies and other merch products

Design de camiseta rainha do halterofilismo

Pronto para imprimir

Cool t-shirt design featuring a woman weightlifting with the caption "Queen"

Design de camiseta de unicórnio musculoso

Pronto para imprimir

A funny t-shirt design featuring a muscular unicorn with pink back drop and a tiny colorful stars around him

Conjunto de silhueta de poses de fitness

Silhouette set featuring fitness people in various poses

Conjunto de ícones de golfe

Collection of different golf icons in black and white

Design de camiseta com citação motivacional de academia de agachamento

texto editÃ¡vel

Pronto para imprimir

Awesome t-shirt design that features a quote that reads "Squat 'til you can't walk"

Design de camiseta com cinto de luta livre

Pronto para imprimir

T-shirt design featuring a golden wrestling belt

Cole??o de silhuetas femininas

Huge set of silhouettes featuring women in different scenarios such as shopping doing sports business and more

Silhueta de menina Pilates com bola

Pilates has became a popular way of becoming fit and healthly

Design de camiseta com citação de fitness calistenia

texto editÃ¡vel

Pronto para imprimir

Cool t-shirt design featuring the quote "My warm up is your workout"

Design de camiseta monocromática de jogador de basquete

texto editÃ¡vel

Pronto para imprimir

Fun t-shirt design featuring a person playing basketball and the quote "Alley hoop, jump shot, hoopster"

Nascido para caiaque design de camiseta engraçada

Pronto para imprimir

Amazing t-shirt design that features a kayak and the quote "Born to kayak, forced to work"

Conjunto de ilustração de prancha de surf

Cool set of surfboards illustration in 7 different styles sizes and color

Fabricante de logotipo de artes marciais

Vetor de esportes 02

Hello there! This is the second set of the sports vector

Animal gato jogando design de camiseta de beisebol

Pronto para imprimir

Awesome t-shirt design featuring a cat playing baseball and the quote "Pawfessional furball batter"

Design de camiseta de futebol de bandeira argentina

texto editÃ¡vel

Pronto para imprimir

Awesome t-shirt design that features the Argentinian flag with a soccer ball

Menino de anime jogando design de camiseta de futebol

Pronto para imprimir

Amazing t-shirt design featuring an anime boy playing soccer

Design de camiseta com citação de futebol americano

Pronto para imprimir

Great sports t-shirt design of two American football players and the quote 'Can't win if you don't play'

Design de t-shirt rainha Dart

Pronto para imprimir

Cool t-shirt design featuring a dartboard with a crown, and the quote "Dart queen"

Pacote de silhueta de estilo livre de motocross

Silhouette pack featuring various motocross freestyle riders performing different stunts

Design de camiseta com emblema de futebol americano

Pronto para imprimir

Cool t-shirt design featuring a sport badge with a football and the quote "Fantasy football legend"

Bowling recortam conjunto

Awesome set of bowling people

Dinossauro T-rex jogando golfe design de camiseta

Pronto para imprimir

Cool t-shirt design featuring a dinosaur playing golf

Design de camiseta de cerveja de time de futebol

ConteÃºdo em alemÃ£o

Fun t-shirt design featuring a german quote related to football and beer

A menina adora o design de camisetas de basquete

Pronto para imprimir

Cool t-shirt design featuring a basketball and the quote "Just a girl who loves basketball"

Design de camiseta para skateboard Heart Line

Pronto para imprimir

T-shirt design featuring a heart line and a skateboarder above it

Design de camisetas Kitesurfer

Pronto para imprimir

T-shirt design featuring a kitesurfer riding on a wave

Ilustração de motocross Heartbeat

Motorcycle featuring a heartbeat illustration with a motocross rider doing a trick

Design de camiseta de mãe de basquete

texto editÃ¡vel

Pronto para imprimir

Cool t-shirt design featuring the title "Basketball mom" with a basketball net and ball, and an animal print background

Levante como um design de camiseta de menina

Pronto para imprimir

Cool t-shirt design that features a strong girl and the quote "Lift like a girl"

Dinossauro T-rex jogando design de camiseta de futebol

Pronto para imprimir

Amazing t-shirt design that features a t-rex dinosaur with a football ball against a rainbow

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Logotipos de bateristas de motocross surf skate

Yes! Rock & Roll is an extreme sport

Conjunto de silhueta de raquetes de padel

Amazing sport-themed set that features a series of silhouettes of paddle tennis racquets, all in different shape and sizes

Design de camiseta de gnomos de minigolfe

texto editÃ¡vel

Pronto para imprimir

Amazing t-shirt design that features gnomes playing mini-golf and the quote "Mini golf squad"

Design fixe de t-shirt de basebol americano

Pronto para imprimir

Great American t-shirt design with the quote "As American as baseball" and a baseball ball with two bats

Silhuetas de jogadores de futebol americano

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Design de camiseta de evolução Pickleball

Pronto para imprimir

An Evolution t-shirt design featuring a sequence of iconic images capturing the progress of evolution, from single-celled organism to a pickleball player

Skeleton skatista fazendo t-shirt de acrobacias psd

Pronto para imprimir

Cool t-shirt psd featuring a person with a skull for a head skateboarding and the quote "Skate your dreams"

de 90

Impulsione seu negóciocom a plataforma gráfica líder para merch