Inscrever-se
Conecte-se
Vexels Logo
All
Pesquisa Aleatória

4968 Gráficos e Designs de e sports para Camisetas e Merch print on demand

Baixar designs de camisetas e para merch, como capas de livro, capas de celular, tote bags e mais de e sports

Resultados patrocinados daShutterstock Logo
Ganhe 15% de desconto com o código: VEXELS15

Design esportivo para mamãe de basquete Desenho PNG

Premiumcrown icon
Bold t-shirt design featuring the phrase Basket Mom and a basketball icon

Conjunto de silhuetas de jogador de voleibol masculino e feminino

Huge pack of volleyball sports silhouette contains mostly female with few male 50 or more players in numerous playing positions

Design estilizado de emblema de basquete com fundo de estrela e sobreposição de banner. Desenho PNG

Premiumcrown icon
Bold emblem design featuring a basketball at the center, surrounded by a star shape and a blank banner for personalization

Design dinâmico de logotipo de beisebol com luva e tacos. Desenho PNG

Premiumcrown icon
Bold baseball logo design featuring a glove, ball, and bats, ideal for sports branding

Design arrojado com emblema de capacete e bola de beisebol Desenho PNG

Premiumcrown icon
Stylish logo design featuring a baseball helmet and baseball, perfect for sports-themed graphics

Design esportivo com emblema de luva e taco de beisebol Desenho PNG

Premiumcrown icon
Bold sports logo design featuring a glove, ball, and crossed bats with a customizable banner

Design divertido de logotipo de beisebol com boné e emblema. Desenho PNG

Premiumcrown icon
Dynamic graphic design featuring a baseball and a cap within a badge and a blank banner

Troféu de basquete vintage com design exclusivo e detalhes decorativos em forma de louro. Desenho PNG

Premiumcrown icon
Dynamic emblem design featuring a basketball, laurel leaves, and a customizable banner below

Guirlanda com design de basquete e faixa personalizável. Desenho PNG

Premiumcrown icon
Classic basketball design featuring a ball and laurel leaves, ideal for trophies or awards

Medalha de reconhecimento no basquete com design e elementos decorativos. Desenho PNG

Premiumcrown icon
Dynamic graphic design featuring a basketball and laurel wreath for awards

Design de troféu de futebol com coroa de louros e faixa em branco Desenho PNG

Premiumcrown icon
Bold vector design featuring a soccer ball, laurel leaves, and a customizable banner for text

Emblema dinâmico de beisebol com tacos cruzados e texto personalizável. Desenho PNG

Premiumcrown icon
Bold badge design featuring a baseball, crossed bats, and a blank ribbon for personalization

Emblema vintage de beisebol com taco e bolas, estilo distintivo. Desenho PNG

Premiumcrown icon
Bold emblem design featuring a bat, baseballs, and a customizable banner

Design elegante de logotipo com coração e basquete Desenho PNG

Premiumcrown icon
Playful logo design featuring a heart-shaped basketball with a blank banner for custom text

Design arrojado com emblema de basquete em chamas e fundo estrelado. Desenho PNG

Premiumcrown icon
Vibrant logo design featuring a basketball with flames and a customizable banner below

Design elegante de escudo de futebol com uma coroa e uma bola de futebol. Desenho PNG

Premiumcrown icon
Eye-catching badge design featuring a crown, soccer ball, and ornate banner

Design esportivo dinâmico do Marrocos com jogador de handebol Desenho PNG

Premiumcrown icon
Striking emblem design featuring a handball player and the word 'Morocco' above, symbolizing athletic spirit

Design dinâmico de emblema esportivo islandês Desenho PNG

Premiumcrown icon
Energetic emblem design featuring a silhouette of an athlete and Icelandic flag elements

Mega Pack Sports Silhouette

Huge set of sports silhouette contains over 100 in action sporting peoples in various poses

Design alegre de futebol com laço e pompom. Desenho PNG

Premiumcrown icon
Playful illustration featuring a football adorned with a bow and a pom-pom

Design de camiseta de esqui na neve e estilo

para Mercht-shirt icon
texto editável
Pronto para imprimir
A cool t-shirt design featuring a skier and the words 'snow and style to descend'

Design de taco e bola de lacrosse Desenho PNG

Premiumcrown icon
This design features a blue lacrosse stick and ball, with a white background

Design divertido de basquete com fita e pompom. Desenho PNG

Premiumcrown icon
Charming illustration featuring a basketball tied with a ribbon and a pom-pom, perfect for sports enthusiasts

Design de pai orgulhoso e amante de esportes com ilustração de futebol Desenho PNG

Playful t-shirt design featuring the text 'Sports Lover' and 'Proud Papa' with a football graphic

Design gráfico esportivo com tema de futebol e flanelas. Desenho PNG

Premiumcrown icon
Playful t-shirt design featuring bold text that reads 'Football & Flannels' for cozy fall vibes

Coleção de silhuetas esportivas

Huge collection of various sports silhouettes

Bolas de futebol e conjunto de países

Premiumcrown icon
Amazing set design that features soccer balls dabbing and country flags like Brazil, USA, Germany and more!

Bicicleta BMX e motocicleta

Bicycle BMX and Motorcycle silhouettes jumping downhill

Banners de handebol boliche e golfe

Set of 3 banners featuring balls for their respective games and sports

Design de camiseta esportiva para casal

para Mercht-shirt icon
texto editável
Pronto para imprimir
Cool t-shirt design featuring a mimic of a sports jersey with the number 01 and the title "His queen"

Vetor de esportes 02

Hello there! This is the second set of the sports vector

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

6 emblemas de esportes radicais

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

6 emblemas de distintivos esportivos

This set of sport badges emblems or insignias feature sport balls with the name of the sport

4 esportes radicais e emblemas de rock

4 Badges in black and white with images of extreme sports like motocross surf and skateboard and also an image of a rock n? roll drummer

Coleção de silhuetas de jogadores esportivos

Collection of 9 different sports' players and athletes

Design de camiseta de esportes de triatlo

para Mercht-shirt icon
Pronto para imprimir
T-shirt design featuring three sports silhouettes for each discipline of Triathlon and the word TRIATHLON in red

Design de camiseta para jogador de beisebol e citações

para Mercht-shirt icon
Pronto para imprimir
Awesome t-shirt design featuring a baseball player with quotes such as pitcher, game, bat, sports and more! Use this print ready design for tshirts, posters, mug, hoodies and other merch products

Conjunto de etiqueta e logotipo de bicicleta

Set of creative bicycle themed logos and label designs in black and white

Bogey é o novo design de t-shirt de golfe par

para Mercht-shirt icon
Pronto para imprimir
Check out this great golfing t-shirt design including a golfer's silhouette and the quote 'Bogey is the new par'

Ícones de jogos esportivos

Sports symbols and icons

Nunca desista de design de cotação de esportes

Premiumcrown icon
Sports quote design saying NEVER GIVE UP

99 Problems Sports T-shirt Design

para Mercht-shirt icon
Pronto para imprimir
T-shirt design featuring a quote saying I GOT 99 PROBLEMS BUT SKILLZ AIN'T ONE

Pacote de silhueta de jogador de tênis masculino e feminino

Set of 24 numerous tennis players in flat black silhouette style illustration

Design de camisetas de gato esportivo

para Mercht-shirt icon
Pronto para imprimir
T-shirt design featuring a sporty cat wearing a headband and sunglasses

Tênis de futebol americano e banners de beisebol

Sports are big parts of our lives and specially entertainment

Design estilizado de escudo com pôr do sol vibrante e marcas de garras para identidade visual esportiva. Desenho PNG

Premiumcrown icon
Striking logo design featuring a shield shape, claw marks, and a central sun motif

Emblema de beisebol com tacos e bola cruzados Desenho PNG

Premiumcrown icon
Dynamic emblem design featuring crossed baseball bats and a ball, perfect for sports teams or enthusiasts

Design gráfico dinâmico de beisebol com taco e chamas. Desenho PNG

Premiumcrown icon
Vibrant graphic design featuring a baseball bat with flames and balls, perfect for sports enthusiasts

Design vintage de emblema de beisebol com boné e bandeira. Desenho PNG

Premiumcrown icon
Dynamic badge design featuring a baseball and cap with a customizable banner for personalization
de 100
Impulsione seu negóciocom a plataforma gráfica líder para merch
VER PLANOS