Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

378 Designs Vetoriais de hiking para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de hiking para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VEXELS15

Seeker man illustration

Não encontramos nenhum hiking Vetores, mas aqui estão todos os nossos hiking designs ou solicitar design aqui

Edit Online Badge

Modelo de design para camiseta Design de acampamento de férias com Papai Noel e fogueira.

Playful t-shirt design showcasing Santa sitting by a campfire with the text 'Merry Miles on the Trail'

Ilustração detalhada de uma bota estilo militar Desenho PNG

Sturdy illustration of classic military boots featuring intricate detailing and laces

Ilustração de botas arrojadas em estilo militar Desenho PNG

Bold illustration of combat boots featuring intricate lacing and detailed textures

Design elegante com estampa tribal de botas Desenho PNG

Unique boot print design showcases intricate tribal patterns for footwear aesthetics

Ilustração estilosa dos detalhes de botas de combate Desenho PNG

Playful graphic design highlighting intricate details of combat boots

Ilustração de bota vintage estilosa Desenho PNG

Unique vintage boot design showcasing intricate lacing and detailed contours

Ilustração detalhada de uma bota de combate. Desenho PNG

Sturdy boot design featuring intricate lacing details and a robust style

Ilustração detalhada de uma lanterna com paisagem montanhosa. Desenho PNG

Unique lantern design featuring a scenic mountain landscape inside

Design de candeeiro a óleo com ilustração de paisagem montanhosa. Desenho PNG

Charming illustration in a lantern showing mountains and a sun motif

Lanterna colorida com desenho de paisagem cênica Desenho PNG

Charming illustration of a camping lantern featuring a serene mountain landscape and river inside

Design gráfico divertido para calçados Desenho PNG

Whimsical design featuring stylized legs in boots, creating a fun and quirky look

Ilustração encantadora de botas de inverno Desenho PNG

Playful graphic design of winter boots featuring fluffy cuffs and buckles

Ilustração de botas de inverno aconchegantes Desenho PNG

Charming illustration of winter boots, featuring a soft fur top and detailed laces

Design elegante com pegada vermelha Desenho PNG

Dynamic footprint design featuring bold red soles and striking star patterns

Design exclusivo da silhueta do tênis Desenho PNG

Minimalist sneaker design featuring a detailed outline of a shoe's sole

Design elegante com estampa de calçado Desenho PNG

Bold graphic design featuring detailed shoe prints with star patterns, perfect for apparel or merchandise

Design gráfico diferenciado para sola de sapato Desenho PNG

Bold graphic design featuring detailed shoe prints, ideal for outdoor and adventure themes

Ilustração exclusiva da sola do tênis Desenho PNG

Stylish graphic design featuring a detailed sneaker footprint pattern

Design gráfico exclusivo com estampa de sapato Desenho PNG

Bold shoe print design featuring detailed tread patterns that showcase a rugged outdoor vibe

Edit Online Badge

Modelo de design para camiseta Design de citação de montanha vintage

Rustic and bold, this poster design features an engaging quote that reads, 'Die Berge Haben Mich Gerufen & Ich Muss Gehen!' The typography combines playful script and vintage-inspired fonts, showcasing a strong emphasis on the word 'Berge,' which translates to 'mountains

Ilustração de bússola com tema de aventura e citação motivacional Desenho PNG

Playful compass design that serves as a poster illustration

Design de cenário de acampamento em montanha Desenho PNG

This t-shirt design features a beautiful mountain camping scene with a tent, a campfire, and a moon in the background

Luminária verde com design de cenário de montanha Desenho PNG

This t-shirt design features a green lamp with a mountain scenery inside

alpinista Desenho PNG

alpinista

Crachá de rótulo de montanha com sol Desenho PNG

Crachá de rótulo de montanha com sol

Paisagem de floresta verde com veados

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

12 emblemas de viagem

12 travel emblems including motivating messages

Lindas bicicletas vetoriais

Collection of 11 different people riding bicycles silhouettes with

Paisagem de inverno com neve e árvores

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Silhueta de alpinista 3 Desenho PNG

Silhueta de alpinista 3

Paisagem plana de floresta montanhosa

Flat landscape illustration featuring lots of mountains and woods

9 emblemas de viagem

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Projeto de paisagem de montanha plana

Flat winter landscape illustration featuring lots of mountains snow and woods

Projeto de ilustração de paisagem de montanha

Flat illustration featuring moutains and their reflection

Silhueta de escalada de montanha Desenho PNG

Silhueta de escalada de montanha

Projeto de paisagem de natureza plana

Flat landscape illustration featuring lots of hills fields and woods

Ilustração de paisagem de floresta com neve

Flat illustration featuring a forest with falling snow and bokeh

Ilustração de uma paisagem de floresta

Flat landscape illustration featuring lots of trees field and river

Ilustração de paisagem de acampamento com fogueira

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Paisagem de floresta e montanhas com veados

Flat landscape illustration featuring lots of trees mountains and a deer

Ilustração de paisagem de montanha

Flat illustration featuring moutains over a blue sky

Paisagem da ilustração do pôr do sol da floresta

Flat landscape illustration featuring a forest with light coming through the tree branches

Logotipo do resort nas montanhas Desenho PNG

Logotipo do resort nas montanhas

Ilustração de paisagem de floresta de inverno

Flat winter illustration featuring a forest with some falling snow

Ilustração do nascer do sol nas montanhas

Low poly illustration featuring moutains and the sun rays coming through them

Ilustração de paisagem de floresta plana

Flat landscape illustration featuring a forest mountain and river

Ilustração de montanha com neve

Flat winter landscape illustration featuring lots of mountains snow and some woods

Conjunto de emblemas editáveis de atividades ao ar livre

Incredible set of 21 editable badges/labels for outdoor activities in cut out style

Ilustração de floresta plana com sol

Flat landscape illustration featuring lots of trees and the sun coming through the branches

de 8

Impulsione seu negóciocom a plataforma gráfica líder para merch