Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

3833 Designs Vetoriais de n para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de n para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VEXELS15

Design de camiseta de sedução cerebral

Eye-catching t-shirt design depicting a man in suit being controlled by a brain-headed figure with red explosion effect in the background and the text "Brain seduction"

Camiseta de pesca com estampa de marlin saltando e bandeira dos EUA

Pronto para imprimir

Dynamic t-shirt design showing a jumping marlin emerging from waves in front of a waving United States flag, rendered with bold lines and strong motion

Conjunto de traçado de decoração de festa de fitas e laços

Amazing decoration themed set that features a series of ribbons and laces to write celebratory messages in stroke style

Design de t-shirt de mão de esqueleto de rock and roll

Pronto para imprimir

Fun t-shirt design featuring a skeleton hand coming out of a coffin with the quote "Rocking on forever"

Crianças olhando para o design de camiseta de avião

Pronto para imprimir

Awesome t-shirt design featuring two children looking at a plane flying in the sky

Design de camiseta de esqui nórdico

texto editável

Pronto para imprimir

Intriguing t-shirt design with a Nordic deity motif merged with a skiing theme, and the text "Pray for Snow"

Estampa de camiseta com ilustração de uma menina caminhando de forma divertida

Pronto para imprimir

Camiseta fotográfica do esquadrão de engenheiros psd

texto editável

Pronto para imprimir

Cool t-shirt psd featuring three engineers walking forward and the quote "Engineer squad"

Design de camisetas rock 'n' roll

Pronto para imprimir

Cool t-shirt design featuring textured musical instruments with the text "Rock 'n' roll" on top

Conjunto de rock and roll de guitarra com caveira

Cool rock and roll style set featuring four different types of electric and accoustic guitars mixed with skull designs

Camiseta com estampa de dragão natalino e árvore

Pronto para imprimir

Funny t-shirt design showing a red dragon about to devour a Christmas tree, blending fantasy and holiday themes

Modelo de logotipo floral com letra n

texto editável

Pacote MNO do Space Garland Letter Vector

Garland letter vector pack featuring M N O letters with the Space theme

Design de camiseta "Brilhe por dentro"

texto editável

Pronto para imprimir

A t-shirt design with a flower and a quote that says 'Shine from within' on the front

Design de camiseta com dragão barbudo

Pronto para imprimir

Funny t-shirt design that features a cartoon style bearded dragon dabbing

Design de padrão de cubos de gelo legal

Pronto para imprimir

Cool pattern design that features ice cubes with sunglasses and quotes like "Be cold", "Ice" and more" Check out this cool pattern, perfect for backgrounds, wallpapers, and more! Contains an editable and repeatable Illustrator vector file

Esquilo bonito sentado no design de t-shirt de toco

Pronto para imprimir

Amazing t-shirt design that features a cute squirrel sitting on a stump

Design de almofada de citação de pai de bigode

Pronto para imprimir

Amazing throw pillow design that features a mustache and the quote "Daddest dad ever"

Desenho de fundo de confete para celebração

Great background design featuring golden confetti thrown into the air

Design de camiseta de ladrão de preguiça

texto editável

Pronto para imprimir

Funny t-shirt design that features a sloth thief and the quote "Do not move"

Design de camiseta de dragão jogando chamas

Pronto para imprimir

Amazing t-shirt design featuring a dragon throwing flames with a gridded background

Conjunto de estilo de tatuagem de animais selvagens de leão

Amazing set that features three lions in different poses surrounded by fire and chains in tattoo style

Design fofo de camiseta com estampa de chá de bolhas e dinossauro

Pronto para imprimir

Playful t-shirt design featuring a cute dinosaur happily sipping bubble tea with hearts around it

Design de camiseta de esqueleto de baterista de rock and roll

Pronto para imprimir

Rock-inspired t-shirt design with a skeleton playing drums, ideal for music lovers

Design de padrão de decoração preto e branco africano

padrão tileable

Amazing pattern design featuring an african design in black and white

Design de camiseta Hustle we grind

texto editável

Pronto para imprimir

This t-shirt design features a man with a green tank top and shorts lifting weights

Pacote de números de letras do alfabeto estilo ocidental

Alphabet style pack featuring Western style letters and numbers

Conjunto de corte de selva de animais selvagens de leão

Amazing animal-themed set that features a series of lions in cut out set

Design de t-shirt da silhueta da evolução do pai

Pronto para imprimir

Great t-shirt design featuring boy to man silhouettes and the quote 'Papa evolution'

Conjunto de elementos náuticos de traçado do oceano

Great nautical-themed set in stroke style that features elements related to ships like boats, ropes, spyglass and more! Each one can be used individually! Enjoy! ?Gran conjunto de tem?tica n?utica en estilo de trazo que presenta elementos relacionados con barcos como botes, cuerdas, catalejos y m?s! ?Cada uno se puede utilizar individualmente! ?Disfrutar! ?timo conjunto com tema n?utico em estilo de tra?ado que apresenta elementos relacionados a navios como barcos, cordas, luneta e muito mais! Cada um pode ser usado individualmente! Aproveitar! Tolles Set mit nautischem Thema im Strichstil, das Elemente enth?lt, die sich auf Schiffe wie Boote, Seile, Ferngl?ser und mehr beziehen! Jeder kann einzeln verwendet werden! Geniessen Sie!

Desenho de camiseta com ilustração de urso bebendo café

Pronto para imprimir

Cool t-shirt design of a grizzly bear holding a cup of coffee

Coleção plana de elementos da natureza da floresta

Awesome nature-themed set that features elements commonly found in the forest such as trees, mountains, lakes and more! Each one can be used individually! ?Impresionante set inspirado en la naturaleza que presenta elementos que se encuentran com?nmente en el bosque, como ?rboles, monta?as, lagos y m?s! ?Cada uno se puede utilizar individualmente! Conjunto incr?vel com tema da natureza que apresenta elementos comumente encontrados na floresta, como ?rvores, montanhas, lagos e muito mais! Cada um pode ser usado individualmente! Tolles Natur-Themen-Set mit Elementen, die im Wald h?ufig vorkommen, wie B?ume, Berge, Seen und mehr! Jeder kann einzeln verwendet werden!

Design de padrão de pele de cobra negra

padrão tileable

Awesome pattern design that includes a black snake skin

Design de camiseta de lobo rock and roll

texto editável

Pronto para imprimir

Awesome t-shirt design that features a wolf with a rock style and the quote "Rocking the wild life"

Conjunto de linha de frequência cardíaca para empregos escolares

Amazing stroke set that features quotes related to school jobs such as "Teacher assistant" and "School counselor"

Coleção de silhuetas de instrumentos musicais

Silhouette collection featuring different musical instruments like drums piano violin guitar and more! Can be used separately

Design de t-shirt de binóculos para observação de pássaros

Pronto para imprimir

Cool t-shirt design featuring a pair of binoculars with birds and the quote "The bird watcher"

Design de camiseta de novos começos de Páscoa

texto editável

Pronto para imprimir

Elegant t-shirt design featuring the phrase "Faith, Hope, and New Beginnings" surrounded by delicate white daisies with yellow centers

Cartão de felicitações de saúde cardíaca enfaixada

texto editável

Cute greeting card in flat style that features a heart covered by a bandage with the quote "Feel better"

Conjunto de rótulos de passatempo de culinária de ingredientes alimentares

Fun food-themed label set that features cooking ingredients such as cheese, bacon, pasta, flout, salt, corn, jelly and many more! Each one can be used individually! Divertido juego de etiquetas con temas de comida que incluye ingredientes para cocinar como queso, tocino, pasta, harina, sal, ma?z, jalea y muchos m?s

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Conjunto de capa de telefone dragão e rosas

Pronto para imprimir

Amazing phone case set that features dragons in different positions, all with roses around

Conjunto de rock and roll de guitarra elétrica de caveira

Awesome rock and roll style element set that features different types of electric guitars mixed with skull designs in a filled-stroke style

Design de camiseta de silhueta de mão Rockstar

texto editável

Pronto para imprimir

Cool t-shirt design featuring a hand doing the rock and roll symbol and the quote "Live like a rockstar"

Desenho de padrão rosa hippie

padrão tileable

Beautiful pattern design featuring colorful guitars hearts flowers peace signs and other hippie culture elements

Desenho de ilustração artística de astronautas

Awesome design featuring a detailed hand drawn illustration of an astronaut

Design divertido de camiseta com carpa koi

Pronto para imprimir

Whimsical t-shirt design featuring two koi fish intertwined, showcasing intricate detailing and vibrant patterns

Modelo de logotipo do clube de rock and roll

Modelo editável

Design de camiseta rock and roll da Am?rica

texto editável

Pronto para imprimir

A vibrant t-shirt design showcasing the American flag in bold colors, with stars and stripes representing the patriotism and pride of America

Animal Alphabet Illustrated Pack MNOP

Animal alphabet letter pack including M N O and P letters

de 77

Impulsione seu negóciocom a plataforma gráfica líder para merch