Preços
Inscrever-se
Conecte-se
Vexels Logo

1868 Designs Vetoriais de silhuetas para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de silhuetas para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados daShutterstock Logo
Ganhe 15% de desconto com o código: VXL15

Silhuetas da cidade de Washington em 4 de julho

Background of Washington city silhouettes with July 4th commemoration theme with buildings and landmarks in colors of USA flag

Conjunto de silhuetas de estrela e brilho

Beautiful sky themed vector set featuring six different style of stars and sparkle silhouettes in white

Ilustração de silhuetas de corrida brilhante

Running design featuring colorful silhouettes of people running and doing sports

Silhuetas da cidade de São Francisco em 4 de julho

Background of San Francisco city silhouettes with July 4th commemoration theme with buildings and landmarks in colors of USA flag

Conjunto de silhuetas de carros e caminhonetes

Collection of silhouettes featuring different cars pickup trucks station wagons and more

Silhuetas de sequência de movimento de cavalo galopando

Horse galloping motion sequence silhouettes

28 ícones quadrados de silhuetas de esportes

This set has 28 icons of many different sports represented as silhouettes within yellow squares

Coleção de silhuetas de fotógrafo

Collection of isolated photographers shooting photos silhouettes in different poses

Silhuetas de fantasias infantis de Halloween

Halloween silhouettes of children with several costumes: witches wizards pirates monsters devils and more

Conjunto de silhuetas de pessoas para caminhadas e escaladas

Premiumcrown icon
People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

20 silhuetas de jogadores de futebol americano

Here is a set with 20 silhouettes of American football players jumping catching and throwing the ball in different positions and moves

Coleção de silhuetas de casas

This vector contains 9 house silhouettes of different sizes and architectures

Coleção de silhuetas de gráficos heráldicos

Silhouette collection featuring numerous heraldic graphics incluing badges lions eagles wings and wreaths

Dove voando silhuetas de sequência

Dove flying sequence silhouettes

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

20 silhuetas de jogadores de beisebol

This set of silhouettes has 20 baseball players in colored uniforms they are hitting the ball with the bat catching the ball running to a base and more plays in different positions

Cervos correndo silhuetas de quadros de movimento

Deer running sequence frames silhouettes

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Conjunto de silhuetas de kick-boxing

Set of kick boxing silhouettes featuring multiple positions and poses

Silhuetas de cidade industrial e ecológica

Pair of city skyline silhouettes features industrial city with factory chimneys and environmental friendly city with wind turbines locomotive and agriculture Par de siluetas del horizonte de la ciudad presenta una ciudad industrial con chimeneas de fabrica y una ciudad ecologica con turbinas eolicas locomotoras y agricultura Par de silhuetas do horizonte da cidade apresenta uma cidade industrial com chamines de fabrica e uma cidade amiga do ambiente com turbinas eolicas locomotiva e agricultura Paar Silhouetten der Skyline der Stadt mit Industriestadt mit Fabrikschornsteinen und umweltfreundlicher Stadt mit Windkraftanlagen Lokomotive und Landwirtschaft

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Silhuetas de jogadores de futebol americano

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Silhuetas de salto de bola de jogadores de futebol

Silhouettes of soccer playersa jumping to hit the ball in various positions; perfect vector for using in sport promos

Conjunto de silhuetas de animais marinhos

Set with 20 silhouettes of sea animals: fishes mammals reptiles mollusks crustaceans etc

Coleção de silhuetas de dragão

Big set of dragon silhouettes in different postures actions and sizes

Conjunto de silhuetas de esportes de neve

Snow sports silhouettes set

Conjunto de silhuetas de pessoas pulando

Silhouette set featuring five people in different jumping positions and pauses and can be use separately

Animal gato em silhuetas de movimento

Cat in motion silhouettes it is running and jumping in a sequence of 20 figures

Silhuetas femininas de compras da Black Friday

Black Friday ad with 3 shopping women silhouettes with bags

Coleção de silhuetas de pessoas sentadas

Collection of isolated casually and formally sitting men and women silhouettes in different poses and from different angles waiting or talking

Sequências de silhuetas de pássaros voando

Flying bird sequence silhouettes

Silhuetas de homens de trabalho com picaretas

Hardworking day labor men silhouettes holding pickaxes with 4 different positions wearing comfortable uniform helmet and shoes

Silhuetas da cidade de Los Angeles em 4 de julho

Background of Los Angeles city silhouettes for July 4th celebration with buildings and landmarks in colors of USA flag

Silhuetas e ilustrações de gatos

Set of cat silhouettes and illustrations in black and white

Silhuetas de colagem de pontos de referência mundiais

This is a nice vector to use in material of travel agencies touristic companies and similar stuff; it has a message of Travel around the world in the center of some circles from which emerge several silhouettes of famous landmarks of continents around the world

Conjunto de silhuetas de dançarinos de salsa

Big set of silhouettes featuring salsa dancers in different poses and postures

Coleção de silhuetas de dançarinos de hip hop

Big set of silhouettes featuring hip hop dancers in different poses and postures

Pacote de silhuetas de artes marciais

Premiumcrown icon
Big set of martial arts silhouettes with lots of positions from different types of martial arts

Desenho de silhuetas de gatos

Seamless pattern design made with two types of cat silhouettes and flowers in tones of pink and green over white background

Conjunto de silhuetas de folhas tropicais

Set of silhouettes featuring illustrated palm tree leaves

Coleção de silhuetas de tango

Big set of silhouettes featuring tango dancers doing different poses and dances

Desenho de silhuetas de tênis brilhantes

Premiumcrown icon
Tennis design featuring colorful silhouettes of people playing tennis

Silhuetas de garotas sexy

Pack of 27 hot girl silhouettes position posing in different sexy and provocative positions

Design de boxe com silhuetas

Boxing design featuring colorful silhouettes of people throwing punches

Conjunto de silhuetas de vacas

Big set of silhouettes featuring different cows in different postures

Conjunto de silhuetas de sereia

Big set of mermaid silhouettes in tones of blue

Coleção de silhuetas em ferradura

Collection of eight isolated horseshoes silhouettes with different design

Reuniões de silhuetas de negócios apertando as mãos

This set of silhouettes collection includes shaking hands and business meetings

Coleção de silhuetas de músicos

Big set of musicians silhouettes featuring musicians playing guitar drums singing and more

15 silhuetas de troféu

This set has 15 silhouettes of trophies with different shapes; some of these have the classical cup design others have a ball a star or a more elegant style
Impulsione seu negóciocom a plataforma gráfica líder para merch
VER PLANOS