Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

1866 Designs Vetoriais de silhuetas para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de silhuetas para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Silhuetas de colagem de pontos de referência mundiais

This is a nice vector to use in material of travel agencies touristic companies and similar stuff; it has a message of Travel around the world in the center of some circles from which emerge several silhouettes of famous landmarks of continents around the world

Cervos correndo silhuetas de quadros de movimento

Deer running sequence frames silhouettes

Conjunto de silhuetas de estrela e brilho

Beautiful sky themed vector set featuring six different style of stars and sparkle silhouettes in white

Ilustração de silhuetas de corrida brilhante

Running design featuring colorful silhouettes of people running and doing sports

Conjunto de silhuetas de carros e caminhonetes

Collection of silhouettes featuring different cars pickup trucks station wagons and more

Design de camiseta de evolução do grill

Pronto para imprimir

Cool t-shirt design that features the grill man evolution

15 silhuetas de troféu

This set has 15 silhouettes of trophies with different shapes; some of these have the classical cup design others have a ball a star or a more elegant style

Design de camiseta com citação de fitness calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring the quote "My warm up is your workout"

Violino formado por design de t-shirt de notas musicais

Pronto para imprimir

Cool t-shirt design that features a violin silhouette formed by musical notes

Mantenha o design de camiseta de meditação focado

Pronto para imprimir

Check this great meditation t-shirt design including a meditating woman's silhouette in a retro sunset background and the quote 'Negativity spreads between minds like locusts

Conjunto de silhuetas de kick-boxing

Set of kick boxing silhouettes featuring multiple positions and poses

Conjunto de silhuetas de dançarinos de salsa

Big set of silhouettes featuring salsa dancers in different poses and postures

Conjunto de silhuetas de pessoas para caminhadas e escaladas

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Conjunto de silhueta de pessoas dançando linha

Check this cool figures set including different people performing line dance! The elements of this set can be isolated for individual use! Mira este genial conjunto de figuras que incluye a diferentes personas bailando en linea! Los elementos de este conjunto se pueden aislar para uso individual! Confira este conjunto de figuras legais, incluindo diferentes pessoas realizando danca de linha! Os elementos deste conjunto podem ser isolados para uso individual! Schauen Sie sich dieses coole Figurenset mit verschiedenen Personen an, die Line Dance auffuhren! Die Elemente dieses Sets konnen zur individuellen Verwendung isoliert werden!

Silhueta fazendo design de camiseta de calistenia

texto editável

Pronto para imprimir

Fun t-shirt design featuring a person exercising and the quote "Never give up only pull up"

Silhuetas de jogadores de futebol americano

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Coleção de silhuetas de dançarinos de hip hop

Big set of silhouettes featuring hip hop dancers in different poses and postures

Coleção de silhuetas de gráficos heráldicos

Silhouette collection featuring numerous heraldic graphics incluing badges lions eagles wings and wreaths

Conjunto de corte de pessoas soprando vidro

Check out this cool cut-out set of people making blown glass objects! Each character of this set can be separated for individual use

Silhuetas de salto de bola de jogadores de futebol

Silhouettes of soccer playersa jumping to hit the ball in various positions; perfect vector for using in sport promos

Design de modelo de caneca de treino de calistenia

texto editável

Pronto para imprimir

Cool mug template featuring a person doing calisthenics and the quote "Just one more rep"

Pacote de silhuetas de artes marciais

Big set of martial arts silhouettes with lots of positions from different types of martial arts

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Design de camiseta de silhueta de esporte de calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring a person doing a pull up and the quote "Push up, pull up, muscle up"

Conjunto de silhuetas de animais marinhos

Set with 20 silhouettes of sea animals: fishes mammals reptiles mollusks crustaceans etc

Conjunto de silhuetas de folhas tropicais

Set of silhouettes featuring illustrated palm tree leaves

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Design de camiseta de força esportiva de calistenia

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a person doing calisthenics and the quote "My body my gym"

Coleção de silhuetas de tango

Big set of silhouettes featuring tango dancers doing different poses and dances

Conjunto de silhuetas de pessoas pulando

Silhouette set featuring five people in different jumping positions and pauses and can be use separately

Coleção de silhuetas de fotógrafo

Collection of isolated photographers shooting photos silhouettes in different poses

Homem fazendo pull ups calistenia design de t-shirt

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a man doing pulls ups and the quote "Pull up and shut up"

Desenho de silhuetas de tênis brilhantes

Tennis design featuring colorful silhouettes of people playing tennis

Animal gato em silhuetas de movimento

Cat in motion silhouettes it is running and jumping in a sequence of 20 figures

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Design de boxe com silhuetas

Boxing design featuring colorful silhouettes of people throwing punches

Silhuetas de poses de ioga

Collection of men and women doing yoga poses silhouettes

Conjunto de silhuetas de vacas

Big set of silhouettes featuring different cows in different postures

Silhuetas femininas de compras da Black Friday

Black Friday ad with 3 shopping women silhouettes with bags

Design de t-shirt de evolução do tênis de padel

Pronto para imprimir

Cool t-shirt design that features the paddle tennis evolution in silhouette style

Conjunto de silhuetas de sereia

Big set of mermaid silhouettes in tones of blue

Design de camisetas de animais da floresta

Pronto para imprimir

Cool t-shirt adorned with a colorful design featuring a deer, bear, eagle, and fox, showcasing his love for nature and wildlife

Sequências de silhuetas de pássaros voando

Flying bird sequence silhouettes

Coleção de silhuetas em ferradura

Collection of eight isolated horseshoes silhouettes with different design

Conjunto de silhueta de esportes de inverno

Cool silhouette set design that features people doing different winter sports like snowboarding and skiing

Coleção de silhuetas de músicos

Big set of musicians silhouettes featuring musicians playing guitar drums singing and more

Conjunto de silhueta de pessoas dançando pop

Awesome hobby-themed set that features a series of people dancing in different ways in silhouette style

Silhuetas de homens de trabalho com picaretas

Hardworking day labor men silhouettes holding pickaxes with 4 different positions wearing comfortable uniform helmet and shoes

Design de camiseta de silhueta T-rex

texto editável

Pronto para imprimir

Cool t-shirt design featuring the word "T-Rex", surrounded with sikhouettes of t-rex dinosaurs

Silhuetas da cidade de Los Angeles em 4 de julho

Background of Los Angeles city silhouettes for July 4th celebration with buildings and landmarks in colors of USA flag

Impulsione seu negóciocom a plataforma gráfica líder para merch