Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

1860 Designs Vetoriais de silhuetas para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de silhuetas para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Conjunto de silhuetas de pessoas para caminhadas e escaladas

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Sequências de silhuetas de pássaros voando

Flying bird sequence silhouettes

Desenho de silhuetas de tênis brilhantes

Tennis design featuring colorful silhouettes of people playing tennis

Coleção de silhuetas de esquilo

Big set of squirrel silhouettes in tones of orange and brown

Conjunto de silhuetas de carros e caminhonetes

Collection of silhouettes featuring different cars pickup trucks station wagons and more

Design de camiseta de evolução do grill

Pronto para imprimir

Cool t-shirt design that features the grill man evolution

Silhuetas de homens de trabalho com picaretas

Hardworking day labor men silhouettes holding pickaxes with 4 different positions wearing comfortable uniform helmet and shoes

Design de camiseta com citação de fitness calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring the quote "My warm up is your workout"

Violino formado por design de t-shirt de notas musicais

Pronto para imprimir

Cool t-shirt design that features a violin silhouette formed by musical notes

Mantenha o design de camiseta de meditação focado

Pronto para imprimir

Check this great meditation t-shirt design including a meditating woman's silhouette in a retro sunset background and the quote 'Negativity spreads between minds like locusts

Silhuetas da cidade de Los Angeles em 4 de julho

Background of Los Angeles city silhouettes for July 4th celebration with buildings and landmarks in colors of USA flag

Coleção de silhuetas de gráficos heráldicos

Silhouette collection featuring numerous heraldic graphics incluing badges lions eagles wings and wreaths

Design de boxe com silhuetas

Boxing design featuring colorful silhouettes of people throwing punches

Conjunto de silhuetas de símbolos africanos de Adinkra

Silhouette set featuring numerous African Adrinka symbols

Silhueta fazendo design de camiseta de calistenia

texto editável

Pronto para imprimir

Fun t-shirt design featuring a person exercising and the quote "Never give up only pull up"

Silhuetas de colagem de pontos de referência mundiais

This is a nice vector to use in material of travel agencies touristic companies and similar stuff; it has a message of Travel around the world in the center of some circles from which emerge several silhouettes of famous landmarks of continents around the world

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Conjunto de silhuetas de vacas

Big set of silhouettes featuring different cows in different postures

Conjunto de silhueta de pessoas dançando linha

Check this cool figures set including different people performing line dance! The elements of this set can be isolated for individual use! Mira este genial conjunto de figuras que incluye a diferentes personas bailando en linea! Los elementos de este conjunto se pueden aislar para uso individual! Confira este conjunto de figuras legais, incluindo diferentes pessoas realizando danca de linha! Os elementos deste conjunto podem ser isolados para uso individual! Schauen Sie sich dieses coole Figurenset mit verschiedenen Personen an, die Line Dance auffuhren! Die Elemente dieses Sets konnen zur individuellen Verwendung isoliert werden!

Conjunto de silhuetas de dançarinos de salsa

Big set of silhouettes featuring salsa dancers in different poses and postures

Design de modelo de caneca de treino de calistenia

texto editável

Pronto para imprimir

Cool mug template featuring a person doing calisthenics and the quote "Just one more rep"

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Conjunto de silhuetas de sereia

Big set of mermaid silhouettes in tones of blue

Conjunto de corte de pessoas soprando vidro

Check out this cool cut-out set of people making blown glass objects! Each character of this set can be separated for individual use

Coleção de silhuetas de dançarinos de hip hop

Big set of silhouettes featuring hip hop dancers in different poses and postures

Design de camiseta de silhueta de esporte de calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring a person doing a pull up and the quote "Push up, pull up, muscle up"

Coleção de silhuetas de fotógrafo

Collection of isolated photographers shooting photos silhouettes in different poses

Fundo das silhuetas da nuvem dos desenhos animados

Backdrop design made from cloud silhouettes in black over white

Design de camiseta de força esportiva de calistenia

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a person doing calisthenics and the quote "My body my gym"

Conjunto de silhuetas de estrela e brilho

Beautiful sky themed vector set featuring six different style of stars and sparkle silhouettes in white

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Coleção de silhuetas em ferradura

Collection of eight isolated horseshoes silhouettes with different design

Homem fazendo pull ups calistenia design de t-shirt

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a man doing pulls ups and the quote "Pull up and shut up"

Ilustração de silhuetas de corrida brilhante

Running design featuring colorful silhouettes of people running and doing sports

Silhuetas de poses de ioga

Collection of men and women doing yoga poses silhouettes

Design de silhuetas de palmeiras

Illustrated palm trees silhouettes in black over white

Pessoa exercitando design de camiseta de calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring a person exercising and the quote "Just one more rep"

Design de t-shirt de evolução do tênis de padel

Pronto para imprimir

Cool t-shirt design that features the paddle tennis evolution in silhouette style

Pacote de silhuetas de artes marciais

Big set of martial arts silhouettes with lots of positions from different types of martial arts

Silhuetas de palmeiras monocromáticas

Set of black palm trees silhouettes over white

Design de camiseta com citação de esporte de calistenia

texto editável

Pronto para imprimir

Amazing t-shirt design featuring the quote "Strong without weights"

Design de camiseta de silhueta T-rex

texto editável

Pronto para imprimir

Cool t-shirt design featuring the word "T-Rex", surrounded with sikhouettes of t-rex dinosaurs

Conjunto de silhuetas de folhas tropicais

Set of silhouettes featuring illustrated palm tree leaves

Coleção de silhuetas de músicos

Big set of musicians silhouettes featuring musicians playing guitar drums singing and more

Homem fazendo design de sacola de calistenia

texto editável

Pronto para imprimir

Amazing tote bag design featuring a person doing calisthenics and the quote "Turn off gravity"

Irmãs jogando design de camiseta

Pronto para imprimir

Look at this cool t-shirt design of two sisters playing on a swing by a tree

5 silhuetas de bruxas de Halloween

Set of Halloween silhouettes featuring evil witches flying in brooms making potions magic and more

Silhuetas de nuvem de desenho animado

Background made from cloud silhouettes in black over white

Design legal de camiseta com amuleto

Pronto para imprimir

Great t-shirt design with a chimney sweep silhouette and the german quote "Everyone needs their lucky charm"

Coleção de silhuetas de tango

Big set of silhouettes featuring tango dancers doing different poses and dances

de 38

Impulsione seu negóciocom a plataforma gráfica líder para merch