Biblioteca de design

Ferramentas de desenho

Recursos

Soluções Corporativas

Inscrever-se

Conecte-se

1860 Designs Vetoriais de silhuetas para Camisetas e Merch

Baixar e comprar Designs Vetoriais AI de silhuetas para Camisetas, Capas do Celular, Capas do Livros e outros produtos Merch

Resultados patrocinados da Shutterstock Logo

Ganhe 15% de desconto com o código: VXL15

Conjunto de silhuetas de pessoas para caminhadas e escaladas

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Coleção de silhuetas de gráficos heráldicos

Silhouette collection featuring numerous heraldic graphics incluing badges lions eagles wings and wreaths

Fundo das silhuetas da nuvem dos desenhos animados

Backdrop design made from cloud silhouettes in black over white

Conjunto de silhuetas de carros e caminhonetes

Collection of silhouettes featuring different cars pickup trucks station wagons and more

Design de camiseta de evolução do grill

Pronto para imprimir

Cool t-shirt design that features the grill man evolution

Design de camiseta com citação de fitness calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring the quote "My warm up is your workout"

Conjunto de silhuetas de estrela e brilho

Beautiful sky themed vector set featuring six different style of stars and sparkle silhouettes in white

Violino formado por design de t-shirt de notas musicais

Pronto para imprimir

Cool t-shirt design that features a violin silhouette formed by musical notes

Mantenha o design de camiseta de meditação focado

Pronto para imprimir

Check this great meditation t-shirt design including a meditating woman's silhouette in a retro sunset background and the quote 'Negativity spreads between minds like locusts

Coleção de silhuetas de esportes radicais

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Ilustração de silhuetas de corrida brilhante

Running design featuring colorful silhouettes of people running and doing sports

Coleção de silhuetas em ferradura

Collection of eight isolated horseshoes silhouettes with different design

Conjunto de silhuetas de símbolos africanos de Adinkra

Silhouette set featuring numerous African Adrinka symbols

Silhueta fazendo design de camiseta de calistenia

texto editável

Pronto para imprimir

Fun t-shirt design featuring a person exercising and the quote "Never give up only pull up"

Coleção de silhuetas de futebol feminino

Huge silhouettes collection featuring women playing soccer in different positions

Pacote de silhuetas de artes marciais

Big set of martial arts silhouettes with lots of positions from different types of martial arts

Coleção de silhuetas de músicos

Big set of musicians silhouettes featuring musicians playing guitar drums singing and more

Conjunto de silhueta de pessoas dançando linha

Check this cool figures set including different people performing line dance! The elements of this set can be isolated for individual use! Mira este genial conjunto de figuras que incluye a diferentes personas bailando en linea! Los elementos de este conjunto se pueden aislar para uso individual! Confira este conjunto de figuras legais, incluindo diferentes pessoas realizando danca de linha! Os elementos deste conjunto podem ser isolados para uso individual! Schauen Sie sich dieses coole Figurenset mit verschiedenen Personen an, die Line Dance auffuhren! Die Elemente dieses Sets konnen zur individuellen Verwendung isoliert werden!

Design de modelo de caneca de treino de calistenia

texto editável

Pronto para imprimir

Cool mug template featuring a person doing calisthenics and the quote "Just one more rep"

Conjunto de silhuetas de folhas tropicais

Set of silhouettes featuring illustrated palm tree leaves

Coleção de silhuetas de fotógrafo

Collection of isolated photographers shooting photos silhouettes in different poses

Cavalo correndo silhuetas de quadros de sequência

Horse running sequence frames silhouettes

Conjunto de corte de pessoas soprando vidro

Check out this cool cut-out set of people making blown glass objects! Each character of this set can be separated for individual use

Design de camiseta de silhueta de esporte de calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring a person doing a pull up and the quote "Push up, pull up, muscle up"

Silhuetas de nuvem de desenho animado

Background made from cloud silhouettes in black over white

Coleção de silhuetas de patinação

Big set of silhouettes featuring people wearing roller skates and skating

Sequência de silhuetas de rebatidas de jogadores de beisebol

Sequence of baseball player batting silhouettes

Design de camiseta de força esportiva de calistenia

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a person doing calisthenics and the quote "My body my gym"

Silhuetas de poses de ioga

Collection of men and women doing yoga poses silhouettes

Coleção de silhuetas de tango

Big set of silhouettes featuring tango dancers doing different poses and dances

Conjunto de 20 silhuetas de rugby

Set with 20 silhouettes of rugby players doing different moves kicking the ball fighting for it running jumping etc

Homem fazendo pull ups calistenia design de t-shirt

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a man doing pulls ups and the quote "Pull up and shut up"

Design de t-shirt de evolução do tênis de padel

Pronto para imprimir

Cool t-shirt design that features the paddle tennis evolution in silhouette style

Desenho de silhuetas de tênis brilhantes

Tennis design featuring colorful silhouettes of people playing tennis

160 silhuetas de animais

Here is a big set with 160 silhouettes of domestic farm and wild animal species

Pessoa exercitando design de camiseta de calistenia

texto editável

Pronto para imprimir

Cool t-shirt design featuring a person exercising and the quote "Just one more rep"

Design de camisetas de animais da floresta

Pronto para imprimir

Cool t-shirt adorned with a colorful design featuring a deer, bear, eagle, and fox, showcasing his love for nature and wildlife

Silhuetas de pássaros voando

Flying bird motion silhouettes

Design de boxe com silhuetas

Boxing design featuring colorful silhouettes of people throwing punches

Design de camiseta com citação de esporte de calistenia

texto editável

Pronto para imprimir

Amazing t-shirt design featuring the quote "Strong without weights"

Design de camiseta de silhueta T-rex

texto editável

Pronto para imprimir

Cool t-shirt design featuring the word "T-Rex", surrounded with sikhouettes of t-rex dinosaurs

Homem fazendo design de sacola de calistenia

texto editável

Pronto para imprimir

Amazing tote bag design featuring a person doing calisthenics and the quote "Turn off gravity"

Conjunto de silhuetas de vacas

Big set of silhouettes featuring different cows in different postures

Irmãs jogando design de camiseta

Pronto para imprimir

Look at this cool t-shirt design of two sisters playing on a swing by a tree

Design de camiseta de força de núcleo esportivo de calistenia

texto editável

Pronto para imprimir

Awesome t-shirt design featuring a person doing calisthenics and the quote "No gravity club"

Design legal de camiseta com amuleto

Pronto para imprimir

Great t-shirt design with a chimney sweep silhouette and the german quote "Everyone needs their lucky charm"

Conjunto de silhueta de evolução do artista

Cool silhouette set design that features the evolution of a paint artist

Conjunto de silhuetas de sereia

Big set of mermaid silhouettes in tones of blue

Conjunto de silhueta de pessoas dançando pop

Awesome hobby-themed set that features a series of people dancing in different ways in silhouette style

Coleção de silhuetas de esquilo

Big set of squirrel silhouettes in tones of orange and brown

de 38

Impulsione seu negóciocom a plataforma gráfica líder para merch